y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10007656
FamilyGH1
Protein PropertiesLength: 506 Molecular Weight: 57394.9 Isoelectric Point: 5.6466
ChromosomeChromosome/Scaffold: 121 Start: 266167 End: 268467
Descriptionbeta glucosidase 46
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1254960
  SPFGDNFLFGTAASSYQFEGAYLSDGKGLSNWDVHSHTPGKIVDGSNGDVAVDSYHRYQEDISLMKSLGVNSYRFSISWSRILPKGRFGQINKVGIAYYN
  ELIDALLAKGVKPFITLCHFDIPQELEDRYGSWLSPLIQEDFGHYADVCFKYFGDRVKYWSTFNEPNFQVAFGYRQGTFPPSRCSGDFGNCTAGNSEREP
  FIAAHNVILSHAAAVEVYRTKYQAEQKGMIGIVLHCAWFEPLSDSEADRLATLRANAFFMNWFFDPILFGRYPEEMKQVLGSTLPEFSGEEVERLKGGLD
  FLGINHYTSYYVKDCMYSECEAGLGTSRTEGYFQQLHERDGIPMGKPGDLDWQYVYPQGMEKMVTYLKDRYNNVPMIISENGYGEVNNPMLTTGDFLKDV
  RRVEYMATYLEGLMAAMRKGADVRGYYAWSLLDNFEWTNGYTQRFGICHVDYKTLERTPKLSAVWLSKFIAK
Full Sequence
Protein Sequence     Length: 506     Download
MRLLLLPFLV AAASFAMKSS ADDNSPFGDN FLFGTAASSY QFEGAYLSDG KGLSNWDVHS    60
HTPGKIVDGS NGDVAVDSYH RYQEDISLMK SLGVNSYRFS ISWSRILPKG RFGQINKVGI    120
AYYNELIDAL LAKGVKPFIT LCHFDIPQEL EDRYGSWLSP LIQEDFGHYA DVCFKYFGDR    180
VKYWSTFNEP NFQVAFGYRQ GTFPPSRCSG DFGNCTAGNS EREPFIAAHN VILSHAAAVE    240
VYRTKYQAEQ KGMIGIVLHC AWFEPLSDSE ADRLATLRAN AFFMNWFFDP ILFGRYPEEM    300
KQVLGSTLPE FSGEEVERLK GGLDFLGINH YTSYYVKDCM YSECEAGLGT SRTEGYFQQL    360
HERDGIPMGK PGDLDWQYVY PQGMEKMVTY LKDRYNNVPM IISENGYGEV NNPMLTTGDF    420
LKDVRRVEYM ATYLEGLMAA MRKGADVRGY YAWSLLDNFE WTNGYTQRFG ICHVDYKTLE    480
RTPKLSAVWL SKFIAKYSKT PIAQM*                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029987.0e-1373494500+
PLN02814PLN028146.0e-14327494470+
COG2723BglB3.0e-14924495479+
TIGR03356BGL2.0e-16729489470+
pfam00232Glyco_hydro_13.0e-17826496475+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC28502.10649625517Similar to F4I1.26 putative beta-glucosidase gi
EMBLCBI23186.102350545527unnamed protein product [Vitis vinifera]
RefSeqXP_002305594.1015054504predicted protein [Populus trichocarpa]
RefSeqXP_002305597.102150532515predicted protein [Populus trichocarpa]
RefSeqXP_002518516.102549732504beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A02749417486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gnp_A02749417486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3gno_A02749417486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B01149615505A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A01149615505A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GW86547329312930
HO785819317233350
HO777739434644960
HO794963426724960
HO794849473204850
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007655Lus10032660Lus10018354Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)