y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10007872
FamilyGH1
Protein PropertiesLength: 510 Molecular Weight: 57196 Isoelectric Point: 5.1962
ChromosomeChromosome/Scaffold: 1317 Start: 67815 End: 70886
Descriptionbeta glucosidase 11
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1194770
  RADFPDGFVFGAGTSAYQVEGAANLDGRTPSVWDTYAHSGYSGGATGDVAVDQYHKYKEDVELMAETGLDSYRFSISWSRLIPGGRGDVNPKGIQYYNNL
  IDELISHGMEPQVSLYNFDHPQIIEDEYGGWVNRKIVGDFREYAEVCFREFGDRVSHWTTVNEPNILASGSYDQGIAPPHRCSPPFGLTACSRGNSSTEP
  YLALHHILLAHASAVKVYREKYQGKQHGLIGISLYSYGYAPYSNSTQDLLAVQRAKQFSLGWVAEPLVYGDYPEIMKRNVGSRLPRFSTEESDMVKGAYD
  FLGLIHYMQMTIKDDPNSLNLEVRDYNADTGTQMMEGLDSYLHGFPVTPWALRDILEDFKHLYGNPPLYIHENGQLNVRNTSLKDTERVEFLHAYMGAAL
  DAIKDGCNVKGYFVWSLLDVFELLGGFRTGFGLYYVDLDDPDLTRYPKLSAHWYSRFLK
Full Sequence
Protein Sequence     Length: 510     Download
MLIIFQLVAD CLGVDEYSRA DFPDGFVFGA GTSAYQVEGA ANLDGRTPSV WDTYAHSGYS    60
GGATGDVAVD QYHKYKEDVE LMAETGLDSY RFSISWSRLI PGGRGDVNPK GIQYYNNLID    120
ELISHGMEPQ VSLYNFDHPQ IIEDEYGGWV NRKIVGDFRE YAEVCFREFG DRVSHWTTVN    180
EPNILASGSY DQGIAPPHRC SPPFGLTACS RGNSSTEPYL ALHHILLAHA SAVKVYREKY    240
QGKQHGLIGI SLYSYGYAPY SNSTQDLLAV QRAKQFSLGW VAEPLVYGDY PEIMKRNVGS    300
RLPRFSTEES DMVKGAYDFL GLIHYMQMTI KDDPNSLNLE VRDYNADTGT QMMEGLDSYL    360
HGFPVTPWAL RDILEDFKHL YGNPPLYIHE NGQLNVRNTS LKDTERVEFL HAYMGAALDA    420
IKDGCNVKGY FVWSLLDVFE LLGGFRTGFG LYYVDLDDPD LTRYPKLSAH WYSRFLKGAT    480
VSSRANIELA VDLSGLTNSG RYPRQHSSR*                                     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL2.0e-13423472456+
pfam00232Glyco_hydro_15.0e-15022478469+
PLN02998PLN02998016478464+
PLN02814PLN02814014495488+
PLN02849PLN0284901480485+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002267643.10114910158PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002267643.101499176668PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268147.101649839523PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002523072.1024894494beta-glucosidase, putative [Ricinus communis]
RefSeqXP_002523075.10249813501beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A01847713487A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB3gnp_A01847713487A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB3gno_A01847713487A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B01847630503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A01847630503A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG217876286733580
JG1016172332785100
JG2385002192925100
CB894344309173250
JG217876293633910.000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00732.1Aquca_015_00033.2Aquca_015_00033.1Aquca_003_00738.1Aquca_003_00734.1
Aquca_018_00002.1Aquca_003_00738.2Aquca_003_00736.1Aquca_003_00738.4Aquca_003_00738.3
Aquca_003_00738.5Aquca_003_00733.2Aquca_003_00733.1Aquca_003_00735.1Aquca_003_00735.2
Aquca_003_00731.1Aquca_003_00734.3Aquca_003_00730.1Aquca_003_00734.2Aquca_003_00735.3
Aquca_003_00733.3Aquca_029_00030.1Aquca_003_00732.2Aquca_015_00029.1Aquca_029_00032.2
Aquca_015_00035.1Aquca_003_00738.7Aquca_015_00034.1Aquca_029_00032.1Aquca_003_00738.6
Aquca_003_00733.4Aquca_003_00734.5Aquca_003_00734.4Aquca_007_00054.1Aquca_003_00738.8
Aquca_003_00738.9Aquca_003_00738.11Aquca_003_00738.10Aquca_035_00146.2Aquca_035_00146.1
Aquca_015_00035.3Aquca_003_00738.12Aquca_015_00033.3Aquca_015_00035.4Aquca_015_00034.2
Aquca_015_00035.2Aquca_003_00738.13Aquca_007_00054.2Aquca_003_00738.15Aquca_003_00738.14
Aquca_003_00733.5Aquca_035_00146.3Aquca_015_00030.1Aquca_003_00735.4
Arabidopsis lyrata491999314159486775878433907850
326101315311486774492664315321
875932
Arabidopsis thalianaAT1G02850.2AT1G02850.5AT4G27830.1AT1G02850.4AT1G02850.3
AT1G02850.1AT4G22100.1AT4G27820.1AT1G45191.2AT1G45191.1
AT1G60090.1AT3G62750.1AT3G62740.1AT1G60260.1AT1G60270.1
AT5G16580.1
Brachypodium distachyonBradi2g59650.1Bradi2g27770.1Bradi3g45627.1Bradi2g59660.1Bradi3g45650.1
Bradi3g45640.1Bradi4g34927.1Bradi4g34950.1Bradi4g34940.1Bradi4g34940.3
Bradi2g09200.1Bradi3g45607.1Bradi4g34940.4Bradi2g09187.1Bradi4g34940.2
Brassica rapaBra033352Bra007699Bra000461.210.665Bra007698Bra034697
Bra014395Bra006755Bra015094Bra021441Bra006756
Bra013234Bra030064Bra015096
Carica papayaevm.TU.contig_25278.3evm.model.supercontig_9.230
Capsella rubellaCarubv10004624mCarubv10007006mCarubv10013516mCarubv10008974mCarubv10011227m
Carubv10017050mCarubv10018691mCarubv10017328m
Citrus clementinaCiclev10019719mCiclev10019788mCiclev10029910mCiclev10028386mCiclev10020433m
Ciclev10020639mCiclev10020770m
Citrus sinensisorange1.1g012181morange1.1g015605morange1.1g015785morange1.1g046009morange1.1g018009m
orange1.1g017505morange1.1g024821morange1.1g020989morange1.1g013298m.26.240orange1.1g013298m.26.240
Cucumis sativusCucsa.097180.1Cucsa.336940.1Cucsa.336950.1
Eucalyptus grandisEucgr.J00646.1Eucgr.J00645.2Eucgr.J00645.1Eucgr.K03473.1Eucgr.J00648.1
Eucgr.J00645.3Eucgr.J00647.1
Fragaria vescamrna03448.1-v1.0-hybridmrna03449.1-v1.0-hybrid
Glycine maxGlyma02g02230.3Glyma14g39230.1Glyma16g19480.1Glyma07g18410.1Glyma07g18400.1
Glyma02g02230.4Glyma02g17490.2Glyma14g39230.2Glyma02g02230.2
Gossypium raimondiiGorai.009G076100.2Gorai.009G076100.1
Linum usitatissimumLus10007871
Malus domesticaMDP0000212560MDP0000135510MDP0000938307
Manihot esculentacassava4.1_032290mcassava4.1_005780mcassava4.1_006332mcassava4.1_022817m
Medicago truncatulaMedtr5g068740.1Medtr1g088610.1Medtr4g016920.1Medtr1g088630.2Medtr1g088630.1
Medtr1g088630.3Medtr1g088630.4Medtr1g088630.5Medtr1g088630.6
Mimulus guttatusmgv1a007433m
Oryza sativaLOC_Os09g33680.1LOC_Os05g30350.1LOC_Os05g30280.3LOC_Os05g30250.1LOC_Os01g59819.1
LOC_Os01g59840.1LOC_Os01g70520.1LOC_Os09g33690.2LOC_Os05g30350.2LOC_Os05g30300.1
LOC_Os09g33710.1LOC_Os05g30280.1LOC_Os09g33680.2LOC_Os01g70520.2LOC_Os09g33690.1
LOC_Os05g30390.1LOC_Os09g33690.4LOC_Os05g30250.2LOC_Os09g33690.3
Panicum virgatumPavirv00030236mPavirv00034053mPavirv00007719mPavirv00011930mPavirv00060992m
Pavirv00043199mPavirv00052823mPavirv00060993mPavirv00000833mPavirv00012938m
Pavirv00034054mPavirv00034055mPavirv00000834mPavirv00004602mPavirv00000835m
Phaseolus vulgarisPhvul.007G145900.1Phvul.008G097600.1Phvul.008G097700.1Phvul.008G097200.1Phvul.008G097000.1
Phvul.008G097100.1Phvul.008G097100.3Phvul.008G097100.2Phvul.008G097300.1
Picea abiesMA_10434198g0010.219.693MA_10434198g0010.219.693MA_139193g0010MA_10436515g0030MA_12813g0010
Prunus persicappa004484mppa006167mppa019582mppa015330m
Ricinus communis29986.m00160629986.m00160129986.m00160329986.m00160229986.m001604
Setaria italicaSi021753mSi021785mSi001092mSi013564mSi032721m
Si013822mSi029509mSi001840mSi002332m
Sorghum bicolorSb02g029640.4Sb02g029640.3Sb02g029640.2Sb03g037780.1Sb09g018160.1
Sb09g018180.2Sb09g018180.1Sb02g029640.1Sb10g022300.1Sb02g029620.1
Thellungiella halophilaThhalv10005908mThhalv10024994mThhalv10004056mThhalv10002493mThhalv10028552m
Thhalv10002501mThhalv10006510mThhalv10004297mThhalv10003058mThhalv10006515m
Vitis viniferaGSVIVT01028006001.499.961GSVIVT01028006001.499.961GSVIVT01028004001.196.654GSVIVT01028004001.196.654GSVIVT01028004001.196.654
GSVIVT01028006001.29.484GSVIVT01028006001.29.484GSVIVT01028001001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)