Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10008206 |
Family | GT4 |
Protein Properties | Length: 188 Molecular Weight: 21792.9 Isoelectric Point: 6.6291 |
Chromosome | Chromosome/Scaffold: 157 Start: 29128 End: 29895 |
Description | sucrose synthase 3 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT4 | 2 | 113 | 1.9e-31 |
EEIEKMHNLMTTYDLSGQFRWITAQTNRAMNGELYRYIADTRGAFVQPAFFEAFGLTVVDAMPCGLPTFATLHGGPAEIIEHGISGFHIDPYHPDQTASQ MADFFQRCKEDP |
Full Sequence |
---|
Protein Sequence Length: 188 Download |
MEEIEKMHNL MTTYDLSGQF RWITAQTNRA MNGELYRYIA DTRGAFVQPA FFEAFGLTVV 60 DAMPCGLPTF ATLHGGPAEI IEHGISGFHI DPYHPDQTAS QMADFFQRCK EDPSYWNKIS 120 GGLKRIYERY TWKIYSERLM TLAGVYSFLK HVSKLERQEP RRYLEMFYIL KFRDLTNTVP 180 LAIDDHV* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00534 | Glycos_transf_1 | 3.0e-16 | 2 | 105 | 104 | + Glycosyl transferases group 1. Mutations in this domain of human PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family. | ||
TIGR02472 | sucr_P_syn_N | 2.0e-18 | 10 | 143 | 136 | + sucrose-phosphate synthase, putative, glycosyltransferase domain. This family consists of the N-terminal regions, or in some cases the entirety, of bacterial proteins closely related to plant sucrose-phosphate synthases (SPS). The C-terminal domain (TIGR02471), found with most members of this family, resembles both bona fide plant sucrose-phosphate phosphatases (SPP) and the SPP-like domain of plant SPS. At least two members of this family lack the SPP-like domain, which may have binding or regulatory rather than enzymatic activity by analogy to plant SPS. This enzyme produces sucrose 6-phosphate and UDP from UDP-glucose and D-fructose 6-phosphate, and may be encoded near the gene for fructokinase. | ||
cd03800 | GT1_Sucrose_synthase | 2.0e-37 | 1 | 141 | 142 | + This family is most closely related to the GT1 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light. | ||
TIGR02470 | sucr_synth | 1.0e-114 | 1 | 182 | 183 | + sucrose synthase. This model represents sucrose synthase, an enzyme that, despite its name, generally uses rather produces sucrose. Sucrose plus UDP (or ADP) becomes D-fructose plus UDP-glucose (or ADP-glucose), which is then available for cell wall (or starch) biosynthesis. The enzyme is homologous to sucrose phosphate synthase, which catalyzes the penultimate step in sucrose synthesis. Sucrose synthase is found, so far, exclusively in plants and cyanobacteria [Energy metabolism, Biosynthesis and degradation of polysaccharides]. | ||
PLN00142 | PLN00142 | 2.0e-135 | 1 | 186 | 187 | + sucrose synthase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009058 | biosynthetic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACF78506.1 | 0 | 1 | 184 | 373 | 557 | unknown [Zea mays] |
DDBJ | BAB20799.1 | 0 | 1 | 185 | 625 | 810 | sucrose synthase 1 [Pyrus pyrifolia] |
Swiss-Prot | O24301 | 0 | 1 | 182 | 625 | 807 | SUS2_PEA RecName: Full=Sucrose synthase 2; AltName: Full=Sucrose-UDP glucosyltransferase 2 |
RefSeq | XP_002465303.1 | 0 | 1 | 184 | 622 | 806 | hypothetical protein SORBIDRAFT_01g035890 [Sorghum bicolor] |
RefSeq | XP_002523115.1 | 0 | 1 | 186 | 588 | 774 | sucrose synthase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3s29_H | 0 | 3 | 185 | 625 | 808 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3s29_G | 0 | 3 | 185 | 625 | 808 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3s29_F | 0 | 3 | 185 | 625 | 808 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3s29_E | 0 | 3 | 185 | 625 | 808 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
PDB | 3s29_D | 0 | 3 | 185 | 625 | 808 | B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GW867922 | 189 | 1 | 188 | 0 |
FN738962 | 186 | 1 | 185 | 0 |
CU597862 | 186 | 1 | 185 | 0 |
FS349380 | 186 | 1 | 185 | 0 |
GW583765 | 186 | 1 | 185 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|