CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10008903
FamilyGH33
Protein PropertiesLength: 335 Molecular Weight: 37122.4 Isoelectric Point: 6.7423
ChromosomeChromosome/Scaffold: 311 Start: 284353 End: 286646
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33173112.7e-29
  FVANSAPFSSCHASTIVEVEKGHFLAAYFGGTSEGASDVKIWIQTYKDGVWQAPMIADEQPGVPLWNPVLFKLPSDEVLLFYKIGQEVQKWSGCMKRSYD
  KGVTWTLREQLPPGILGPSKNKPLLLETGLLLCGSSVESWNSWGSWVEVTADAGKTWRKYGPIYIENRSLSVIQPVPYRTTKGTLRVLMRSFDGIDRVCI
  SESLDGGVSWGYAKPTELPNPNSGIDGVKLRDGRVLLAYNTASRAVLKVAVSEDEGDSWCDVLTLEDQQGMEFSYPAVIQDSDGLVHITYTYKRT
Full Sequence
Protein Sequence     Length: 335     Download
MSKGCSPWSP LRAEFTFVAN SAPFSSCHAS TIVEVEKGHF LAAYFGGTSE GASDVKIWIQ    60
TYKDGVWQAP MIADEQPGVP LWNPVLFKLP SDEVLLFYKI GQEVQKWSGC MKRSYDKGVT    120
WTLREQLPPG ILGPSKNKPL LLETGLLLCG SSVESWNSWG SWVEVTADAG KTWRKYGPIY    180
IENRSLSVIQ PVPYRTTKGT LRVLMRSFDG IDRVCISESL DGGVSWGYAK PTELPNPNSG    240
IDGVKLRDGR VLLAYNTASR AVLKVAVSED EGDSWCDVLT LEDQQGMEFS YPAVIQDSDG    300
LVHITYTYKR TQIKVTTQWC LLCSLRNRMN LSNA* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4692COG46924.0e-2723314344+
pfam13088BNR_23.0e-9038304282+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18568.10131434347unknown [Glycine max]
RefSeqNP_851204.101131414317BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqXP_002263578.101031458362PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324495.1013141314predicted protein [Populus trichocarpa]
RefSeqXP_002531744.1013141314conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DV137355268403070
EL689016287193050
EY11451026262670
DV145816255372910
ES962106261322920
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny