y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10010201
FamilyCBM49
Protein PropertiesLength: 627 Molecular Weight: 69384.4 Isoelectric Point: 8.3097
ChromosomeChromosome/Scaffold: 587 Start: 246683 End: 249530
Descriptionglycosyl hydrolase 9C1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM495356132.2e-29
  AFLHSITQSWTVGTTTYYRHKVTIKNMSQKPITSIKLVAQNLLGSIWGLTPAPEKDTYVLPEWVKVLQPGSEINFVYVQ
GH9334940
  DYGDALDKTFLFLEAQRSGKLPLTDQRVKWRGDSGLRDGHLQGVDLVGGYYDAGDHVKFGLPMAFSVTMMAWGAVDFEKDIVLTDQMGNTLRAIRWGTDY
  FLKAHTQPNVLWAQVGDGDSDHYCWERAEDMTTSRTSYKLDQNNPGSDLAGETAAALAASALAFKPYNSSYSNLLLAHAKQLFSFADRFRGLYDDSIQNA
  KQFYTSSGYSDELLWAATWLYRATSDEYYLKYCADNAVYMGGTGWAVKEFSWDNKYAGVQILLSKILLEGRGGQYTQTLKQYQAKADYFACACVQKNDGY
  NIHKTPGGLMYVREWNNMQYVSAAAFLTAVYSQYLTASNAKLTCPRGQLVEPRELLGFAKSQADYILGKNPKSISYMVGYGQQYPIHVHHRGASIASIFL
  LRSSVECVQGFETWYRKADANPNVVYGALVGGPDQNDNFSDQRANYEQTEPTLTASAPLIGL
Full Sequence
Protein Sequence     Length: 627     Download
MKNKFNISPS AAAAICNLLL CSHMVLGLAQ GLDYGDALDK TFLFLEAQRS GKLPLTDQRV    60
KWRGDSGLRD GHLQGVDLVG GYYDAGDHVK FGLPMAFSVT MMAWGAVDFE KDIVLTDQMG    120
NTLRAIRWGT DYFLKAHTQP NVLWAQVGDG DSDHYCWERA EDMTTSRTSY KLDQNNPGSD    180
LAGETAAALA ASALAFKPYN SSYSNLLLAH AKQLFSFADR FRGLYDDSIQ NAKQFYTSSG    240
YSDELLWAAT WLYRATSDEY YLKYCADNAV YMGGTGWAVK EFSWDNKYAG VQILLSKILL    300
EGRGGQYTQT LKQYQAKADY FACACVQKND GYNIHKTPGG LMYVREWNNM QYVSAAAFLT    360
AVYSQYLTAS NAKLTCPRGQ LVEPRELLGF AKSQADYILG KNPKSISYMV GYGQQYPIHV    420
HHRGASIASI FLLRSSVECV QGFETWYRKA DANPNVVYGA LVGGPDQNDN FSDQRANYEQ    480
TEPTLTASAP LIGLFSKLQS ASGNRGYQPK ASPVTHYTKP TPAPKTVTGS HVPLAFLHSI    540
TQSWTVGTTT YYRHKVTIKN MSQKPITSIK LVAQNLLGSI WGLTPAPEKD TYVLPEWVKV    600
LQPGSEINFV YVQGGPQAKF SVLSYQ*                                        660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN02340012626615+
PLN02171PLN02171010625633+
PLN02420PLN02420031517489+
PLN00119PLN00119014498485+
pfam00759Glyco_hydro_9033496466+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005576extracellular region
GO:0005975carbohydrate metabolic process
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27137.103262628615unnamed protein product [Vitis vinifera]
RefSeqNP_175323.103362530626AtGH9C1 (Arabidopsis thaliana glycosyl hydrolase 9C1); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqXP_002277177.10386261575PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310080.102862522610glycosyl hydrolase family 9 [Populus trichocarpa]
RefSeqXP_002527135.102962624620endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0334824412A Chain A, Pectin Methylesterase From Carrot
PDB1ksc_A0334824412A Chain A, Pectin Methylesterase From Carrot
PDB1ks8_A0334824412A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB2xfg_A03249824459B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
PDB4tf4_B0325654490B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO783495378374130
DY9681622721964670
DY287831345243670
DY274365379243990
CF9215552562745270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01464.1.518.596Aquca_037_00141.1.542.619Aquca_013_00114.1.534.611
Arabidopsis lyrata474038.535.614489943.534.611892975.528.605
Arabidopsis thalianaAT1G64390.1.528.605AT1G48930.1.535.614AT4G11050.1.534.611
Brachypodium distachyonBradi2g32270.1.538.616Bradi2g07150.1.534.613
Brassica rapaBra032270.517.596Bra000732.268.345Bra027699.529.606Bra018765.532.611Bra027735.528.605
Carica papayaevm.model.supercontig_183.4.367.446evm.TU.contig_27379.2.529.606
Capsella rubellaCarubv10012624m.534.613Carubv10003874m.535.612Carubv10019981m.528.605
Citrus clementinaCiclev10019301m.537.614Ciclev10033912m.569.648
Citrus sinensisorange1.1g043219m.499.578orange1.1g019436m.249.326orange1.1g017562m.277.354orange1.1g011712m.387.464orange1.1g006835m.537.614
Cucumis sativusCucsa.107370.1.527.604Cucsa.128330.1.503.582Cucsa.303850.1.533.608
Eucalyptus grandisEucgr.D01733.1.529.606Eucgr.J00862.1.484.562Eucgr.E00858.1.526.602Eucgr.D01896.1
Fragaria vescamrna32087.1-v1.0-hybrid.632.709mrna11058.1-v1.0-hybrid.533.612
Glycine maxGlyma12g03050.1.537.616Glyma05g36930.1.532.609Glyma08g02610.1.533.610Glyma11g10760.1.535.614
Gossypium raimondiiGorai.003G080800.1.533.609Gorai.008G254000.1.534.611Gorai.004G133700.1.536.613Gorai.005G210200.1.530.608
Linum usitatissimumLus10003888.529.606Lus10010201.535.613Lus10032377.534.611Lus10017402.508.586Lus10001833.527.603
Lus10033956
Malus domesticaMDP0000276676.536.613MDP0000131267.528.605MDP0000548943MDP0000722052.313.390MDP0000826600.538.616
Manihot esculentacassava4.1_004404m.486.565cassava4.1_003698m.530.607
Medicago truncatulaMedtr4g074960.1.571.649
Mimulus guttatusmgv1a003302m.501.580
Oryza sativaLOC_Os01g12070.1.544.625LOC_Os01g12030.1.543.620LOC_Os04g57860.1.531.610LOC_Os05g12150.1.535.613
Panicum virgatumPavirv00000152m.548.625Pavirv00066185m.348.426Pavirv00000772m.535.612Pavirv00030375m.537.614Pavirv00029375m.528.607
Physcomitrella patensPp1s176_127V6.1.544.623
Phaseolus vulgarisPhvul.011G030300.1.567.645Phvul.002G297600.1.530.607
Picea abiesMA_895058g0010MA_10437098g0010.516.596MA_127108g0010.524.603MA_42717g0010.527.604MA_10241783g0010.543.621
MA_19509g0020.547.626
Populus trichocarpaPotri.003G139600.1.530.607Potri.001G092200.1.530.607Potri.001G092200.5.285.362Potri.007G071200.1.520.599Potri.007G071200.2.519.598
Potri.001G092200.4.375.452
Prunus persicappa002939m.528.605ppa022524m.499.578
Ricinus communis29675.m000388.528.607
Setaria italicaSi000642m.549.626Si021474m.530.607Si021476m.528.606
Selaginella moellendorffii234652.525.60399802.550.630
Sorghum bicolorSb09g006670.1.535.612Sb03g001560.1.561.639Sb06g032760.1.534.615
Thellungiella halophilaThhalv10023353m.527.604Thhalv10011318m.534.613Thhalv10028514m.535.612
Vitis viniferaGSVIVT01019523001.537.614GSVIVT01012043001.524.602
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)