Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10010467 |
Family | GT1 |
Protein Properties | Length: 125 Molecular Weight: 14230.4 Isoelectric Point: 7.9647 |
Chromosome | Chromosome/Scaffold: 910 Start: 280133 End: 280507 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 2 | 119 | 3.1e-27 |
SFIWVVRESEQDKLPRGFISDDTLCLVVEWCRQPEVPSHPFFGCFVTHCGWNSTMEAVSLGVPVVKLSIWVDQPTNAKFVEDVWHVRVRAKADVAKEIGR RIKEVMEGENGKRLEGMR |
Full Sequence |
---|
Protein Sequence Length: 125 Download |
MSFIWVVRES EQDKLPRGFI SDDTLCLVVE WCRQPEVPSH PFFGCFVTHC GWNSTMEAVS 60 LGVPVVKLSI WVDQPTNAKF VEDVWHVRVR AKADVAKEIG RRIKEVMEGE NGKRLEGMRR 120 SGRN* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02210 | PLN02210 | 6.0e-23 | 1 | 120 | 134 | + UDP-glucosyl transferase | ||
PLN02448 | PLN02448 | 5.0e-24 | 3 | 120 | 125 | + UDP-glycosyltransferase family protein | ||
PLN02152 | PLN02152 | 5.0e-25 | 3 | 123 | 140 | + indole-3-acetate beta-glucosyltransferase | ||
PLN02555 | PLN02555 | 4.0e-27 | 1 | 90 | 97 | + limonoid glucosyltransferase | ||
PLN02173 | PLN02173 | 6.0e-40 | 2 | 116 | 123 | + UDP-glucosyl transferase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACR10263.1 | 1e-36 | 2 | 115 | 302 | 423 | UDP-glucosyl transferase 74c1 [Brassica rapa subsp. pekinensis] |
DDBJ | BAD95102.1 | 2e-35 | 2 | 116 | 275 | 397 | putative glucosyltransferase [Arabidopsis thaliana] |
RefSeq | NP_180738.1 | 2e-35 | 3 | 115 | 304 | 424 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
RefSeq | NP_181912.1 | 2e-35 | 2 | 116 | 293 | 415 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
RefSeq | NP_973682.1 | 2e-35 | 2 | 116 | 293 | 415 | UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 1e-19 | 2 | 116 | 326 | 446 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c9z_A | 3e-18 | 3 | 123 | 303 | 426 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c1z_A | 3e-18 | 3 | 123 | 303 | 426 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2c1x_A | 3e-18 | 3 | 123 | 303 | 426 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
PDB | 2vg8_A | 0.000000000000007 | 3 | 113 | 300 | 433 | A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FG401170 | 120 | 2 | 115 | 6e-37 |
FG401948 | 120 | 2 | 115 | 8e-37 |
FD548544 | 131 | 2 | 124 | 2e-36 |
EX659410 | 122 | 1 | 115 | 2e-36 |
FD544719 | 131 | 2 | 124 | 4e-36 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|