y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10011147
FamilyGH1
Protein PropertiesLength: 647 Molecular Weight: 73183.3 Isoelectric Point: 5.6185
ChromosomeChromosome/Scaffold: 1558 Start: 307320 End: 310889
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11725470
  FHHNVAAWHNVPHPEERLRFWSDPDTELKLAKDAGVTVFRMGIDWTRIMPEEPVNGLKDAVNFAALERYKWIISRVHSYGMKVMLTLFHHSLPPWAGEYG
  GWKLEKTVDYFMDFTRLVVDAVSELVDYWITFNEPHIFCMLTYCAGAWPGGHPDMLEVATSALPFGVFNMAMNWIALAHSKSYAFIHENCTNPVVGVAHH
  VSFMRPYGLFDVAAVQFANSRTIFPFIDSIAEKLDYIGINYYGQEVVSGVGLKLVETDEYSESGRGVYPDGLFRVLLQFHERYKHLNVPFIITENGVADE
  TDVIRRPYLLEHLLAVYAAMILGTPVLGYLFWTISDNWEWADGYGPKFGLVAVDRNNNLARNPRPSYHLFSKVARS
Full Sequence
Protein Sequence     Length: 647     Download
MAFLTLVVSA TKVAGVLVSL TVASNAISFW RFQKKNLKSF EPGIDETSEI LAAFNVDGGE    60
SEFFFGLATA PAHVEDRLND AWLQFAEETP ADVSLPQGDL QPADAVLVSD GEDGGSQQAS    120
LSPKELAKVA KRKKSIKVSM EAMIRGFEKY TEEEDKEEDK EEEEVPLPSE EFHHNVAAWH    180
NVPHPEERLR FWSDPDTELK LAKDAGVTVF RMGIDWTRIM PEEPVNGLKD AVNFAALERY    240
KWIISRVHSY GMKVMLTLFH HSLPPWAGEY GGWKLEKTVD YFMDFTRLVV DAVSELVDYW    300
ITFNEPHIFC MLTYCAGAWP GGHPDMLEVA TSALPFGVFN MAMNWIALAH SKSYAFIHEN    360
CTNPVVGVAH HVSFMRPYGL FDVAAVQFAN SRTIFPFIDS IAEKLDYIGI NYYGQEVVSG    420
VGLKLVETDE YSESGRGVYP DGLFRVLLQF HERYKHLNVP FIITENGVAD ETDVIRRPYL    480
LEHLLAVYAA MILGTPVLGY LFWTISDNWE WADGYGPKFG LVAVDRNNNL ARNPRPSYHL    540
FSKVARSGKI TREDRDQAWG ELQSAAKQKK TRPFYRAVNK SGLMYAGGLD EPIEREYIAR    600
DWRFGHYEME GLQDPLSRLS RCVLRPFIRK RKGRRNAQPL VLQPLA*                  660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG1.0e-22185525414+
PRK13511PRK135113.0e-28186550450+
TIGR03356BGL1.0e-54199541386+
pfam00232Glyco_hydro_12.0e-56196547412+
COG2723BglB9.0e-65199551409+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ87636.1016451635putative beta-glycosidase [Glycine max]
EMBLCAJ87637.1016461639putative beta-glycosidase [Solanum lycopersicum]
EMBLCBI22845.1016451615unnamed protein product [Vitis vinifera]
RefSeqXP_002280268.1016451644PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316058.1016441611predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ha4_A9.99995e-4118555353471A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB4ha3_A9.99995e-4118555353471A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris
PDB1vff_A3e-3919255349411A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii
PDB3apg_D1e-3718555352460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C1e-3718555352460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Transmembrane Domains
StartEnd
1330
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8410083252125330
CX0459473042885890
GO8386793243136330
GO8544993302195450
GO8579233022285260
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10043048
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny