y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10011800
FamilyAA3
Protein PropertiesLength: 402 Molecular Weight: 43882.1 Isoelectric Point: 7.7843
ChromosomeChromosome/Scaffold: 610 Start: 261289 End: 262494
Descriptionfatty alcohol oxidase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA3443951.4e-27
  EDHYCGSCGYGCRRGDKKGTDSTWLVDAVEQGAVILTGCKAERFILQENKGSEGRRRKLRCSGVTARIMGGCKIQSKLEIQATVTISACGSLQTPPLLFR
  SGLKNKHIGRNLHLHPVAMAWGYFPESNAEMKGKAYEGGIITSMHKVLSEEETIKAILETPMLGPSQFVALCPWESGSDFKARMLRYSRTSHIIVIVKDV
  GSGEVKREGRVTYPVDSRDRENVRIGLQRALRILVAAGAVEVGTHRSDGQRLKCEGIGEKELDEFIESVTASRGAMSVGEEEWMVYTSAHQMGSCRMGFG
  EEDGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMITIQSTAYCLSKRIAET
Full Sequence
Protein Sequence     Length: 402     Download
MDKVWERLRV TEKCAAEGLQ NQVLRKGCEN LGLEVHSVAR NSSEDHYCGS CGYGCRRGDK    60
KGTDSTWLVD AVEQGAVILT GCKAERFILQ ENKGSEGRRR KLRCSGVTAR IMGGCKIQSK    120
LEIQATVTIS ACGSLQTPPL LFRSGLKNKH IGRNLHLHPV AMAWGYFPES NAEMKGKAYE    180
GGIITSMHKV LSEEETIKAI LETPMLGPSQ FVALCPWESG SDFKARMLRY SRTSHIIVIV    240
KDVGSGEVKR EGRVTYPVDS RDRENVRIGL QRALRILVAA GAVEVGTHRS DGQRLKCEGI    300
GEKELDEFIE SVTASRGAMS VGEEEWMVYT SAHQMGSCRM GFGEEDGAVD ENGESWEAKG    360
LFVCDGSVLP SAVGVNPMIT IQSTAYCLSK RIAETLKITS A*                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02462pyranose_ox0.00533339765+
TIGR03970Rv06972.0e-630439698+
COG2303BetA7.0e-1721394408+
pfam05199GMC_oxred_C3.0e-22253388136+
pfam00732GMC_oxred_N6.0e-481160162+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71289.101397344736hypothetical protein [Vitis vinifera]
RefSeqXP_002285334.101397344736PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311685.101397350742predicted protein [Populus trichocarpa]
RefSeqXP_002314488.101396322713predicted protein [Populus trichocarpa]
RefSeqXP_002528823.101397347743disulfide oxidoreductase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2gew_A0.0002333385442489A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1n4w_A0.0002333385442489A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1n4v_A0.0002333385442489A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1n4u_A0.0002333385442489A Chain A, Raphanus Sativus Anionic Peroxidase.
PDB1n1p_A0.0002333385442489A Chain A, Raphanus Sativus Anionic Peroxidase.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79475339813980
HO811216329713990
HO77922430813080
EX275136297943900
ES806453295593530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)