| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10011852 |
| Family | GH17 |
| Protein Properties | Length: 140 Molecular Weight: 14728.2 Isoelectric Point: 8.2045 |
| Chromosome | Chromosome/Scaffold: 754 Start: 88663 End: 89082 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 33 | 116 | 9.1e-25 |
| IGVNYGRLATSLPSPAQVVELLKSQGITLVKIFDANSDVFTALAGSNISNISVTVCLPNGFVSAAAADQTVADYWVHSNISPFY | |||
| Full Sequence |
|---|
| Protein Sequence Length: 140 Download |
| MATFSKIPMS LFILLALICT LVPADAAVEG RFIGVNYGRL ATSLPSPAQV VELLKSQGIT 60 LVKIFDANSD VFTALAGSNI SNISVTVCLP NGFVSAAAAD QTVADYWVHS NISPFYTLPP 120 ILKPSPSGTS LPSLILYRR* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 5.0e-21 | 33 | 116 | 84 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAZ40342.1 | 6e-23 | 33 | 116 | 22 | 102 | beta-1,3-glucanase 2 [Ziziphus jujuba] |
| DDBJ | BAB17320.1 | 6e-23 | 33 | 116 | 24 | 104 | elicitor inducible beta-1,3-glucanase NtEIG-E76 [Nicotiana tabacum] |
| DDBJ | BAC53928.1 | 1e-22 | 33 | 116 | 24 | 104 | beta-1,3-glucanase-like protein [Nicotiana tabacum] |
| RefSeq | XP_002316783.1 | 4e-22 | 33 | 116 | 4 | 84 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002529472.1 | 1e-21 | 33 | 116 | 31 | 111 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.00000002 | 33 | 116 | 1 | 81 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 4gzj_A | 0.00000002 | 33 | 112 | 3 | 78 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 4gzi_A | 0.00000002 | 33 | 112 | 3 | 78 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
| PDB | 3ur8_B | 0.00000003 | 33 | 112 | 3 | 78 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
| PDB | 3ur8_A | 0.00000003 | 33 | 112 | 3 | 78 | A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase In Complex With Laminaratriose |
| Transmembrane Domains | ||||
|---|---|---|---|---|
 | ||||
| Start | End | |||
| 7 | 29 | |||
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 26 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FN711592 | 116 | 1 | 116 | 2e-29 |
| FP042814 | 116 | 1 | 116 | 3e-28 |
| FN736822 | 116 | 1 | 116 | 3e-28 |
| FP055084 | 116 | 1 | 116 | 7e-28 |
| FP040485 | 116 | 1 | 116 | 1e-27 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |