y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10012162
FamilyGH9
Protein PropertiesLength: 624 Molecular Weight: 69319.4 Isoelectric Point: 9.191
ChromosomeChromosome/Scaffold: 1186 Start: 245785 End: 248227
Descriptionglycosyl hydrolase 9A1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91135870
  NYTLALHKALMFFNAQKSGKLPKHNNVSWRGNSCMNDGKGDSSTLFKDLVGGYYDAGDAIKFNFPKSFAMTMLSWSVIEYSAKYEAVGELNHIKDIIKWG
  TDYLLKTFNHTADTIDRIVSQVGSGDTSGGSTTPNDHYCWTRPEDIDYERPVTECHTCSDLAAEMAAALASASIVFKDNKAYSQKLVHGARTLFKFSRDQ
  RGRYSAGSAEAGTFYNSTSYWDEFVWAGTWLYYATGNNSYLSLATTPGIAKHAGAFWGGPDYGVFSWDNKLTGAQVLLSRLRLFLSPGYPYEEILRTFHN
  QTSIVMCSYLPYFSSFNRTKGGLIQLNHGRPQPLQYVVNSAFLASVYADYLEAADTPGWYCGPNFFSTKILRDFAKTQIDYVLGKNPRKMSYVVGFGNHY
  PKHVHHRGASVPHNKVKYSCKGGWKWRDTKKPNPNTLVGAMVAGPDRHDGFKDVRMNYNYTEPTLAGNAGLVAAL
Full Sequence
Protein Sequence     Length: 624     Download
MSMYGRDPWG GPLEINTADS ATDDDRSRNL NDLDRAALSN SRPLDETQQS WLLGPTEQKK    60
KKRYVDLGCI IVSRKIFIWT LGTLLAAGLL TGLIIIIVKY APRHHHPKPP PDNYTLALHK    120
ALMFFNAQKS GKLPKHNNVS WRGNSCMNDG KGDSSTLFKD LVGGYYDAGD AIKFNFPKSF    180
AMTMLSWSVI EYSAKYEAVG ELNHIKDIIK WGTDYLLKTF NHTADTIDRI VSQVGSGDTS    240
GGSTTPNDHY CWTRPEDIDY ERPVTECHTC SDLAAEMAAA LASASIVFKD NKAYSQKLVH    300
GARTLFKFSR DQRGRYSAGS AEAGTFYNST SYWDEFVWAG TWLYYATGNN SYLSLATTPG    360
IAKHAGAFWG GPDYGVFSWD NKLTGAQVLL SRLRLFLSPG YPYEEILRTF HNQTSIVMCS    420
YLPYFSSFNR TKGGLIQLNH GRPQPLQYVV NSAFLASVYA DYLEAADTPG WYCGPNFFST    480
KILRDFAKTQ IDYVLGKNPR KMSYVVGFGN HYPKHVHHRG ASVPHNKVKY SCKGGWKWRD    540
TKKPNPNTLV GAMVAGPDRH DGFKDVRMNY NYTEPTLAGN AGLVAALIAL SGDGTSNIDK    600
NTIFSAVPPM FPTPPPPPAP WKP*                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02613PLN026131.0e-110112592492+
PLN02171PLN021711.0e-110113592490+
PLN02266PLN022663.0e-114104591501+
PLN02345PLN023455.0e-145117594488+
pfam00759Glyco_hydro_92.0e-166113587481+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC49704.1036071601endo-1,4-beta-glucanase [Solanum lycopersicum]
GenBankAAS45400.1036071603endo-1,4-beta-glucanase [Populus tremuloides]
GenBankAAT75041.1036071603Cel9A [Populus tremula x Populus tremuloides]
RefSeqXP_002332697.1036071603hypothetical protein POPTRDRAFT_675657 [Populus trichocarpa]
RefSeqXP_002519394.1016071605endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A01135904428A Chain A, Pnb Esterase
PDB1ksc_A01135904428A Chain A, Pnb Esterase
PDB1ks8_A01135904428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B01105902440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A01105902440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
7698
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BF01044461016070
HO794674568416070
HO7962134751356070
HO778339453464970
HO7783391114976070
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032858221894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma20g06820.1
Glyma06g12910.2Glyma06g12910.3Glyma04g41891.1
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.2Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10026863Lus10018918Lus10028619Lus10010029
Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1Phvul.009G135900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)