y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10012868
FamilyGH1
Protein PropertiesLength: 690 Molecular Weight: 77802.4 Isoelectric Point: 5.4389
ChromosomeChromosome/Scaffold: 1313 Start: 254051 End: 259761
Descriptionbeta glucosidase 32
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH12136000
  YEFPDDFIFGTATSSYQIEGAHDFTFGKGPSTWDRFTHSYPDRILGGGNGDVALDHYHKYMEDIGKMKYLNVDAYRFSISWPRIIPSGKRSDGVNQEGIN
  FYHTLLDALNANGIKAFVTMYHWETPQGLEAEYGGFLSRNIVKDFEDYSDLLFQEYGSKVYKWITLNEPMGNSMKSYDEGVFAPGHCSVWVDRKCRLGDS
  STEPYIVTHNQLLAHSAAYHLYKTKYTNLTAEIGITLVTHWFLPYDNTSSKDIDAAQRALDWLYGWYMDPLTYGYYPRTMVDLLGSRLPQFTQEESHLLK
  KSFDFLGLNYYTGYYVKNVNDDDFDQVHLRYATDHHGITTPDRDGEYIGPHLGSYWQYLYPEGLRVLLEYTKEKYDDPIIYITENGTE
Full Sequence
Protein Sequence     Length: 690     Download
MQLFGSCGPP VISAYLKTSG CEMLILLGRL LVLSFMVGLK LMIWQLAGIA VGGSSAASVS    60
TLPSSLFSIS CVCSFCVDWR YGLNEYAGSC FPPGFIFGTA TSSFQIEGAP NFAYGKGPSI    120
WDRFTHRHPG LCEFRALIDF STKTSPLDFL ADDVDSFVAD WILEGGNGDV AIDHYHKYKV    180
AAGSPLILAD DGDPCSASTY VYKPSPELPK GRYEFPDDFI FGTATSSYQI EGAHDFTFGK    240
GPSTWDRFTH SYPDRILGGG NGDVALDHYH KYMEDIGKMK YLNVDAYRFS ISWPRIIPSG    300
KRSDGVNQEG INFYHTLLDA LNANGIKAFV TMYHWETPQG LEAEYGGFLS RNIVKDFEDY    360
SDLLFQEYGS KVYKWITLNE PMGNSMKSYD EGVFAPGHCS VWVDRKCRLG DSSTEPYIVT    420
HNQLLAHSAA YHLYKTKYTN LTAEIGITLV THWFLPYDNT SSKDIDAAQR ALDWLYGWYM    480
DPLTYGYYPR TMVDLLGSRL PQFTQEESHL LKKSFDFLGL NYYTGYYVKN VNDDDFDQVH    540
LRYATDHHGI TTPDRDGEYI GPHLGSYWQY LYPEGLRVLL EYTKEKYDDP IIYITENGTE    600
SQVNVKGYFA WSYADNFEWN EGFTVRFGLY YVNYTDLSRH PKNSACWFTN FASKTSPKSS    660
LFNYFDLDQL IAARVALGGR RALSSAGRP*                                     720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00232Glyco_hydro_11.0e-149118090+
TIGR03356BGL1.0e-169217988+
COG2723BglB8.0e-115212648473+
TIGR03356BGL2.0e-134216648465+
pfam00232Glyco_hydro_18.0e-155215655475+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAO49267.10.0000005851792588AF480476_1 P66 protein [Hevea brasiliensis]
GenBankAAO49267.1021165927509AF480476_1 P66 protein [Hevea brasiliensis]
GenBankABL01537.10.0000006851792588beta glucosidase [Hevea brasiliensis]
GenBankABL01537.1021165927509beta glucosidase [Hevea brasiliensis]
RefSeqXP_002285582.1021265435509PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B019665415505A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1
PDB3ptq_B0.00004911793491A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1
PDB3ptq_A019665415505A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1
PDB3ptq_A0.00004911793491A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1
PDB3ptm_B019665415505A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG0618792421934340
JG0617842281934200
HO7948494582126340
JG06187989911790.000000000000001
JG06178489911790.000000000000001
Orthologous Group
SpeciesID
Arabidopsis lyrata917734489446
Arabidopsis thalianaAT5G25980.1AT5G26000.1AT5G48375.1AT5G25980.2AT1G51490.1
AT5G26000.2AT5G25980.3
Brassica rapaBra016676Bra039823Bra039705Bra039824Bra004012
Bra014287Bra038094Bra023838Bra032343Bra036914
Bra020523.35.161Bra020523.35.161Bra020549
Carica papayaevm.model.supercontig_17.152
Capsella rubellaCarubv10000656mCarubv10007356m.543.827Carubv10007356m.543.827Carubv10006917mCarubv10022237m
Carubv10007356m.45.502Carubv10007356m.45.502
Thellungiella halophilaThhalv10002474mThhalv10004165mThhalv10001184mThhalv10002471mThhalv10002470m
Thhalv10003945mThhalv10003954mThhalv10012086mThhalv10000681mThhalv10011390m
Thhalv10012108m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny