CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10015337
FamilyGH38
Protein PropertiesLength: 1249 Molecular Weight: 142412 Isoelectric Point: 6.9036
ChromosomeChromosome/Scaffold: 635 Start: 4803 End: 10326
Descriptiongolgi alpha-mannosidase II
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH381582481.4e-30
  KVIVMPHSHNDPGWKLTVDEYYEKQSRHILDTIVETLSKDVRRKFIWEEMSYLEKWWRDASEGKRASFTKLVKNGQLEIVGGGWVMNDELT
GH382485710
  TVDEYYEKQSRHILDTIVETLSKDVRRKFIWEEMSYLEKWWRDASEGKRASFTKLVKNGQLEIVGGGWVMNDEANSHFFSIIEQITEGNIWLNDTIGIIP
  KNSWAIDPFGYSSTMAYLLRRMGFENMLIQRTHYELKKELALHRNLEFVWRQSWDAGETTDIFVHMMPFYSYDIPHTCGPEPAICCQFDFARVPGFFYEL
  CPWHQNPEETTPENVHERAKLLLDQYKKKSVLYRTNTLLIPLGDDFRYVTVDEAEAQYRNYQMLFDHINSNPSLNAEAKFGTLDDYFQALHEESDRKNYS
  VPGEIGSSHIGGFPSLSGDFFTYA
Full Sequence
Protein Sequence     Length: 1249     Download
MPLSSYIGSR RGGGSVGGSG SGWPQSILPT STTSKSKLIP SRKPRKRGAL INFLFTNFFT    60
ISLSISLLFL FFTVLHFGFP KPLFSSAFSS MPSPPVRQRK TTVRRNSIQN GMSNGTTVDL    120
TTKDLYDKIK FLDKDGGPWK QGWRVSYRGN EWDDEKLKVI VMPHSHNDPG WKLTVDEYYE    180
KQSRHILDTI VETLSKDVRR KFIWEEMSYL EKWWRDASEG KRASFTKLVK NGQLEIVGGG    240
WVMNDELTVD EYYEKQSRHI LDTIVETLSK DVRRKFIWEE MSYLEKWWRD ASEGKRASFT    300
KLVKNGQLEI VGGGWVMNDE ANSHFFSIIE QITEGNIWLN DTIGIIPKNS WAIDPFGYSS    360
TMAYLLRRMG FENMLIQRTH YELKKELALH RNLEFVWRQS WDAGETTDIF VHMMPFYSYD    420
IPHTCGPEPA ICCQFDFARV PGFFYELCPW HQNPEETTPE NVHERAKLLL DQYKKKSVLY    480
RTNTLLIPLG DDFRYVTVDE AEAQYRNYQM LFDHINSNPS LNAEAKFGTL DDYFQALHEE    540
SDRKNYSVPG EIGSSHIGGF PSLSGDFFTY ADREQDYWSG YYVSRPFFKA VDRVLEQTLR    600
ATEMMVALFV GHCQRLQCEK LVIGFSHKLT AARRNLALFQ HHDGVTGTAK DHVVRDYGMR    660
MHTSLEDLQI FMSKAIEVLL GMHLEKLDLN PAKFEAEQVR AKYNVQPVHK ALSPSEGTAQ    720
SVVLFNPTEQ VREEVVMVVV NRPDVTVLDS NWTCVQSQVS PELQHDGNNI FSGRHRVHWK    780
ASVPAMGLET YYVANGYVGC EKAKPAKLKY VSPNSFSCPT SYACSKAAGD WAEIQNGQQT    840
LTFNINHGLL QNVKHKNGSS YVMAEEIGMY SSDGSGAYLF KPIGDAKSII QNDGITVITE    900
GPLMQEVFSY PNTAFRRNPV SHSTRIYNGG NTVQEFVVET EYHVELLGDE FNDRELIVRY    960
KTDIDNKGVF YSDLNGFQMS RRETYDKIPL QGNYYPMPSL AFIQGSNGDR FSVNSRQSLG    1020
VASLKDGWLE IMVDRRLLRD DGRGLGQGVT DNRPMNVVFH LLFETNISST SNPVSNPVPL    1080
SPSLLSHRIG AHLNYPLFAF ISKDHEELSL QTYGRSFSPL AASLPCDLHI VNFKVARPAL    1140
FSRELVGDPR FVRDPRFILI FQRRQWDASY CRTGRSQCTR FADVPVNIFN MFQGFSVLNA    1200
EATSLNLLHD DMDVLGYNEK VGDVSEDGRV SISPMEIQAY KLELRPNQ*                1260
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd10809GH38N_AMII_GMII_SfManIII_like4.0e-48156266111+
PLN02701PLN027015.0e-80118246129+
cd11666GH38N_Man2A13.0e-145240582343+
PLN02701PLN02701024012451009+
cd10809GH38N_AMII_GMII_SfManIII_like0240582343+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004559alpha-mannosidase activity
GO:0005975carbohydrate metabolic process
GO:0006013mannose metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196999.1024012481661173GMII (GOLGI ALPHA-MANNOSIDASE II); alpha-mannosidase [Arabidopsis thaliana]
RefSeqXP_002276468.1092465227PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002276468.1024012461511149PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002517418.1012461257mannosidase alpha class 2a, putative [Ricinus communis]
RefSeqXP_002517418.1018912481221180mannosidase alpha class 2a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1hxk_A0240111164913A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hxk_A6e-321092462140A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A0240111164913A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hww_A6e-321092462140A Chain A, Golgi Alpha-Mannosidase Ii In Complex With Deoxymannojirimicin
PDB1hty_A0240111164913A Chain A, Golgi Alpha-Mannosidase Ii
Transmembrane Domains
StartEnd
5375
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7891222692405080
FL7143862733185900
CB6620862813626420
FN7613372503395880
HO789122851622463e-39
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00345.1.265.483Aquca_002_00345.1.265.483Aquca_006_00230.1Aquca_006_00257.5Aquca_006_00257.9
Aquca_006_00257.8Aquca_006_00257.7Aquca_006_00257.6Aquca_006_00257.4Aquca_006_00257.3
Aquca_006_00257.2Aquca_006_00257.1Aquca_043_00016.7Aquca_043_00016.8Aquca_043_00016.6
Aquca_043_00016.5Aquca_043_00016.4Aquca_043_00016.3Aquca_043_00016.2Aquca_043_00016.1
Aquca_043_00019.2Aquca_043_00019.1Aquca_043_00018.1Aquca_056_00071.1Aquca_002_00345.1.162.261
Aquca_002_00345.1.162.261
Arabidopsis lyrata488339488225497001484445
Arabidopsis thalianaAT5G14950.1AT5G66150.1AT5G13980.3AT5G13980.2AT5G13980.1
AT3G26720.2AT3G26720.1
Brachypodium distachyonBradi1g44550.1Bradi3g21117.1Bradi4g17327.1Bradi4g17317.1
Brassica rapaBra023496Bra006275Bra037183Bra006227Bra025225
Carica papayaevm.model.supercontig_6.275evm.model.supercontig_70.70evm.model.supercontig_2646.1evm.TU.contig_36966.1evm.model.supercontig_70.69
Capsella rubellaCarubv10000075mCarubv10002909mCarubv10027738mCarubv10016625m
Citrus clementinaCiclev10014083mCiclev10017635mCiclev10024829mCiclev10024800mCiclev10030627m
Ciclev10014156mCiclev10014160mCiclev10014123m
Citrus sinensisorange1.1g002547morange1.1g002518morange1.1g002134morange1.1g001061morange1.1g015028m
orange1.1g002366morange1.1g004057morange1.1g001910morange1.1g001850morange1.1g002764m
orange1.1g002170morange1.1g002162morange1.1g002383morange1.1g001963morange1.1g001813m
orange1.1g002938morange1.1g002542morange1.1g002064morange1.1g002056morange1.1g002046m
orange1.1g002036m
Cucumis sativusCucsa.339310.1Cucsa.043720.1Cucsa.188400.2Cucsa.188400.1
Eucalyptus grandisEucgr.J02166.1Eucgr.L01536.1Eucgr.J02456.1Eucgr.K02195.1Eucgr.J02455.3
Eucgr.J02455.2Eucgr.J02455.1Eucgr.I01600.1Eucgr.G01931.1Eucgr.J02460.1
Eucgr.J02454.1Eucgr.L01537.1Eucgr.J02457.1Eucgr.J02459.2Eucgr.J02459.1
Fragaria vescamrna28330.1-v1.0-hybridmrna14585.1-v1.0-hybridmrna01394.1-v1.0-hybrid.37.348mrna01394.1-v1.0-hybrid.37.348mrna06416.1-v1.0-hybrid.39.351
mrna06416.1-v1.0-hybrid.39.351mrna14589.1-v1.0-hybrid.71.344
Glycine maxGlyma13g04761.3Glyma13g04761.2Glyma19g01890.1Glyma13g04761.1Glyma02g05240.2
Glyma02g05240.1Glyma16g23600.1Glyma01g36980.1Glyma06g17270.1Glyma04g37790.1
Glyma19g27660.2Glyma19g27660.1Glyma16g05240.2Glyma16g05240.1
Gossypium raimondiiGorai.001G258600.2Gorai.001G258600.1Gorai.006G027500.1Gorai.003G008600.2Gorai.003G008600.1
Gorai.006G000300.3Gorai.006G000300.2Gorai.006G000300.1Gorai.012G082700.6Gorai.012G082700.9
Gorai.012G082700.8Gorai.012G082700.7Gorai.012G082700.5Gorai.012G082700.4Gorai.012G082700.3
Gorai.012G082700.2Gorai.012G082700.10Gorai.012G082700.1Gorai.003G116600.2Gorai.003G116600.1
Linum usitatissimumLus10014507Lus10015337.248.571Lus10015337.248.571Lus10032179Lus10039457
Lus10012578Lus10035111Lus10012577Lus10036074Lus10025960
Lus10014259Lus10041516Lus10015337.158.248Lus10015337.158.248
Malus domesticaMDP0000888429MDP0000267909MDP0000250936MDP0000139458MDP0000274501
MDP0000274500MDP0000409920MDP0000163211MDP0000657082MDP0000211018
Manihot esculentacassava4.1_000571mcassava4.1_001602mcassava4.1_000993mcassava4.1_000971mcassava4.1_000869m
cassava4.1_001123mcassava4.1_001106m
Medicago truncatulaMedtr4g071680.1Medtr6g008850.1Medtr8g075330.1Medtr7g084040.1Medtr3g098650.2
Medtr3g098650.1Medtr7g084030.1
Mimulus guttatusmgv1a000435mmgv1a000658mmgv1a000852mmgv1a000690m
Oryza sativaLOC_Os06g13650.2LOC_Os06g13650.1LOC_Os06g13650.3LOC_Os11g32260.2LOC_Os11g32260.1
LOC_Os10g05069.2LOC_Os10g05069.1LOC_Os10g05069.3
Panicum virgatumPavirv00027286mPavirv00014532mPavirv00024149mPavirv00025946mPavirv00065120m
Physcomitrella patensPp1s10_34V6.1Pp1s77_136V6.1Pp1s129_147V6.1
Phaseolus vulgarisPhvul.004G022500.1Phvul.003G264400.1Phvul.001G084400.1Phvul.002G107300.1Phvul.001G084700.1
Phvul.009G161600.1
Picea abiesMA_10434251g0010MA_879613g0010MA_4107059g0010
Populus trichocarpaPotri.017G073900.2Potri.017G073900.1Potri.001G350400.2Potri.001G350400.1Potri.014G143600.1
Potri.014G143600.2Potri.007G056300.1Potri.002G238200.2Potri.002G238200.1Potri.012G106500.2
Potri.012G106500.1
Prunus persicappa000458mppa021513mppa000707mppa000755mppa000717m
Ricinus communis29822.m00342029868.m00034130131.m00698230131.m00698130147.m014412
Setaria italicaSi005719mSi038673mSi025964mSi034056mSi025881m
Selaginella moellendorffii104910154366266756410022178241
Sorghum bicolorSb10g008770.1Sb01g026405.1Sb05g019600.1Sb01g026390.1
Thellungiella halophilaThhalv10012487mThhalv10012612mThhalv10012546mThhalv10003575mThhalv10003577m
Vitis viniferaGSVIVT01032586001GSVIVT01018752001GSVIVT01032988001GSVIVT01008340001GSVIVT01008642001
GSVIVT01032989001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)