y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10018353
FamilyGH1
Protein PropertiesLength: 509 Molecular Weight: 57454.9 Isoelectric Point: 5.1183
ChromosomeChromosome/Scaffold: 251 Start: 42952 End: 45286
Descriptionbeta glucosidase 46
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1284990
  SPFGDNFLFGTAASSYQFEGAYLSDGKGLSNWDVHSHTPGKIVDGSNGDVAVDSYHRYQEDISLMKSLGVNSYRFSISWPRILPKGSFGEINEAGITYYN
  ELIDALLAKGVEPFITLCHFDIPQELEDRYGSWLSPLIQEDFGHYADVCFKYFGDRVKYWSTFNEPNFQVAFGYRQGTFPPSRCSGDFGNCTAGNSETEP
  FIAAHNVILSHAAAVEVYRTKYQAEQKGMIGIVLHCAWFEPLSDSEADRLATLRANAFFMNWFFDPILFGRYPEEMKQVLGSTLPEFTGEEVERLKGGLD
  FLGINHYTSYYVKDCMYSECEAGLGTSRTEGYFQQLHERDGIPMGKPGDLDWQYVYPQGMEKMVTYLKDRYNNVPMIISENGYGEVNNPMLTTGDFLKDV
  RRVEYMATYLDGLMAAMRKGADVRGYYAWSLLDNFEWTNGYTQRFGICHVDYKTLERTPKLSAIWLSKFIAK
Full Sequence
Protein Sequence     Length: 509     Download
MRLLLLHLLV AVAASASFAV RSAAAANSPF GDNFLFGTAA SSYQFEGAYL SDGKGLSNWD    60
VHSHTPGKIV DGSNGDVAVD SYHRYQEDIS LMKSLGVNSY RFSISWPRIL PKGSFGEINE    120
AGITYYNELI DALLAKGVEP FITLCHFDIP QELEDRYGSW LSPLIQEDFG HYADVCFKYF    180
GDRVKYWSTF NEPNFQVAFG YRQGTFPPSR CSGDFGNCTA GNSETEPFIA AHNVILSHAA    240
AVEVYRTKYQ AEQKGMIGIV LHCAWFEPLS DSEADRLATL RANAFFMNWF FDPILFGRYP    300
EEMKQVLGST LPEFTGEEVE RLKGGLDFLG INHYTSYYVK DCMYSECEAG LGTSRTEGYF    360
QQLHERDGIP MGKPGDLDWQ YVYPQGMEKM VTYLKDRYNN VPMIISENGY GEVNNPMLTT    420
GDFLKDVRRV EYMATYLDGL MAAMRKGADV RGYYAWSLLD NFEWTNGYTQ RFGICHVDYK    480
TLERTPKLSA IWLSKFIAKY SKTPIAQM*                                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029982.0e-13330497474+
PLN02814PLN028148.0e-14230497470+
COG2723BglB5.0e-14927498479+
TIGR03356BGL3.0e-16832492470+
pfam00232Glyco_hydro_13.0e-18029499475+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI23186.10950828527unnamed protein product [Vitis vinifera]
RefSeqNP_850968.10349911506BGLU46 (BETA GLUCOSIDASE 46); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002305594.1035082504predicted protein [Populus trichocarpa]
RefSeqXP_002305597.101450822515predicted protein [Populus trichocarpa]
RefSeqXP_002518516.102850032504beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A03049717486A Chain A, Treponema Denticola Variable Protein 1
PDB3gnp_A03049717486A Chain A, Treponema Denticola Variable Protein 1
PDB3gno_A03049717486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_B01149912505A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3ptq_A01149912505A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO777739434674990
HO785819315283380
HO794963426754990
HO794849468284880
CX6352262911264160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma15g11290.2Glyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1
Glyma12g35140.2Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10007656Lus10007655Lus10032660Lus10018354Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)