y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10020234
FamilyGH1
Protein PropertiesLength: 158 Molecular Weight: 18244.6 Isoelectric Point: 4.6009
ChromosomeChromosome/Scaffold: 454 Start: 771691 End: 772454
Descriptionbeta glucosidase 42
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1201460
  EKAASEWLYVCPWGLRKVLNYVAKTYKSPKIYITENGMDDEDSDAPLEEMLDDKMRVRYFKGYLKAVAEAIRDGVDVKGYFAWSLLDNFEWAQGYTKRFG
  IVYVDYKDGELTRHPKSSAYWFLRFLK
Full Sequence
Protein Sequence     Length: 158     Download
MFLISTVSSD EWEDGEPIGE KAASEWLYVC PWGLRKVLNY VAKTYKSPKI YITENGMDDE    60
DSDAPLEEML DDKMRVRYFK GYLKAVAEAI RDGVDVKGYF AWSLLDNFEW AQGYTKRFGI    120
VYVDYKDGEL TRHPKSSAYW FLRFLKGGEE GKDTKQE*                            180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2723BglB7.0e-3222141121+
PRK13511PRK135111.0e-3231141112+
PLN02998PLN029982.0e-3331147117+
pfam00232Glyco_hydro_16.0e-4519147129+
TIGR03356BGL2.0e-4519141125+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM21577.1091501141AF451279_1 beta-glucosidase-like protein [Phaseolus vulgaris]
GenBankAAP51059.1011156346489latex cyanogenic beta glucosidase [Hevea brasiliensis]
EMBLCBI23349.1011157192337unnamed protein product [Vitis vinifera]
RefSeqXP_002265653.1011147179315PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002514775.1011156348500beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B7.00649e-4513145371503B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB3ptq_A7.00649e-4513145371503B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB3ptm_B7.00649e-4513145371503B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB3ptm_A7.00649e-4513145371503B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
PDB3ptk_B7.00649e-4513145371503A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG267673148111580
JG243160148111580
JG233765148111580
JG089858148111580
JG092651148111580
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.124evm.model.supercontig_88.6
Capsella rubellaCarubv10019488m
Fragaria vescamrna00446.1-v1.0-hybrid
Glycine maxGlyma08g15960.3.242.369Glyma08g15960.3.242.369
Linum usitatissimumLus10030515.313.435Lus10026861Lus10020500Lus10030515.313.435
Malus domesticaMDP0000196383MDP0000151948MDP0000292674MDP0000201747.130.258MDP0000201747.130.258
MDP0000205601.303.434MDP0000205601.303.434MDP0000716537
Manihot esculentacassava4.1_028771m.269.395cassava4.1_028771m.269.395cassava4.1_030081m
Panicum virgatumPavirv00007277mPavirv00051180m
Picea abiesMA_10427912g0010MA_10330649g0010MA_10432745g0010
Populus trichocarpaPotri.011G130200.1Potri.001G223200.1
Vitis viniferaGSVIVT01032009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny