y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10020500
FamilyGH1
Protein PropertiesLength: 1151 Molecular Weight: 128285 Isoelectric Point: 9.0411
ChromosomeChromosome/Scaffold: 44 Start: 708104 End: 715644
DescriptionLeucine-rich receptor-like protein kinase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1101911401.7e-33
  MTACDWLYIYPEGLLEILVHVKNEYDIPIFLTENGVADLSNNSLPINDDLDDKLRIKFHFLQSVKDGDNVNGYTFWSLLENFEWELGCVVRFGITFIDFG
  NDLKRYPKRSALWFRDFLQKQQ
Full Sequence
Protein Sequence     Length: 1151     Download
MLEGELHELK PLTKLASLQL FENQFSGEIP EEIGELKGLT EISLYRNKLV GSIPQKIGSW    60
ADFYYIDVSE NFLTGQIPPD MCKMGQMTDL LLLQNKLTGE IPASYADCKS LVRLRVNNNS    120
LTGSIPPGIW GLPNISVIDL SMNQFEGSVT DAIGRAKSLG LFNLANNRFS GNLPAAISEA    180
SLLVSVLFSF NRFTGSIPER IGELKKLSSF YLDGNTFSGT IPSSLGACVS LSDINFFGNI    240
LSGEIPEALG SLKNLNSLNL SSNKLSGEIP ICLSSIRLSN LDLSNNQLMG RIPSSLSLEA    300
FRQGFTGNPG LCSETLDDFH RCSSRSAKSG HLRVFLWCFT AIMLVLVFSI CLFFLSMNLR    360
SQEKSPLGCV LKHNSSWNMK SFRVLSFRES DIITAIKSEN LIGKGGSGNV YKATIGNGSK    420
ELAVKHIWMT NNNQGGSCRS SSAILAKDKK KLWSPEFEAE VATLSTVRHV NVVKLYCSIT    480
SEDSNLLVYE YLPNGSLWDK LHSSSEKVVM DWELRYAIAL GSARGLEYLH HCFDRPVIHR    540
DVKSSNILLD EEWNPRIADF GLAKILHGSS TVDNWSHGIA GTHGYMAPEY GYTTKINEKS    600
DVYSFGVVLM ELVTGKRPIH EPEFGEKKDI VEWVYNKLMS KESTIASIVD SNISDSLKED    660
AVQVLKIAVR CTANVPTLRP SMRMVVHMLE EAQPSLALDL SRVVVVGKEG EKVAGNFGSP    720
AALLFPTSFN PLQLCVNVDM APKRGVKAPA LTKKKPEKIS NPLFEKRPKQ FGIGGALPPK    780
RDLTRFVKWP HVVRIQRQRR ILKQRLKVPP AVNQFTKALD KNLATQMFKL LLKYRPEDKA    840
AKKERLISKA KAEAEGKTVE SKKPIVVKYG LNHVTYLIEQ NKAQLVIIAH DVDPIELVVW    900
LPALCRKMEV PYAIVKGKSR LGAIVHKKTA AALCLTSVKN EDKMEFSKIL EAVKANFNDK    960
FDEHRKRWGG GIMGSKSQAK TKAKERLLAK EAAQRILVCN GTFSLHHFHI DGSMDANVMT    1020
ACDWLYIYPE GLLEILVHVK NEYDIPIFLT ENGVADLSNN SLPINDDLDD KLRIKFHFLQ    1080
SVKDGDNVNG YTFWSLLENF EWELGCVVRF GITFIDFGND LKRYPKRSAL WFRDFLQKQQ    1140
NVTTLLNPDM *                                                         1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00113PLN001131.0e-371308317+
PLN00113PLN001136.0e-3815297284+
PLN00113PLN001131.0e-4012296309+
PLN00113PLN001139.0e-882692702+
PTZ00365PTZ003654.0e-90747978232+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0005975carbohydrate metabolic process
GO:0006468protein phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002313944.102708258949predicted protein [Populus trichocarpa]
RefSeqXP_002313944.14e-23429691385predicted protein [Populus trichocarpa]
RefSeqXP_002313944.14e-234297114434predicted protein [Populus trichocarpa]
RefSeqXP_002313944.11e-191530253371predicted protein [Populus trichocarpa]
RefSeqXP_002313944.13e-166634556394predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3izr_H07409961257PP Chain p, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome
PDB3j3b_G074999616265L Chain L, Structure Of The Human 60s Ribosomal Proteins
PDB2zkr_f074999616265DD Chain d, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map
PDB3j39_G076199534269H Chain H, Structure Of The D. Melanogaster 60s Ribosomal Proteins
PDB4a1e_F07549953252H Chain H, Structure Of The D. Melanogaster 60s Ribosomal Proteins
Transmembrane Domains
StartEnd
334356
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BU089563685146920
GW8647082437369780
EG6944012397409780
GE6334812387409770
JG0068682367429770
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.124evm.model.supercontig_88.6
Capsella rubellaCarubv10019488m
Fragaria vescamrna00446.1-v1.0-hybrid
Glycine maxGlyma08g15960.3.242.369Glyma08g15960.3.242.369
Linum usitatissimumLus10030515.313.435Lus10026861Lus10020234Lus10030515.313.435
Malus domesticaMDP0000196383MDP0000151948MDP0000292674MDP0000201747.130.258MDP0000201747.130.258
MDP0000205601.303.434MDP0000205601.303.434MDP0000716537
Manihot esculentacassava4.1_028771m.269.395cassava4.1_028771m.269.395cassava4.1_030081m
Panicum virgatumPavirv00007277mPavirv00051180m
Picea abiesMA_10427912g0010MA_10330649g0010MA_10432745g0010
Populus trichocarpaPotri.011G130200.1Potri.001G223200.1
Vitis viniferaGSVIVT01032009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny