| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10020526 |
| Family | GH17 |
| Protein Properties | Length: 86 Molecular Weight: 9522.06 Isoelectric Point: 9.9759 |
| Chromosome | Chromosome/Scaffold: 77 Start: 64202 End: 64459 |
| Description | O-Glycosyl hydrolases family 17 protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 2 | 85 | 4.2e-25 |
| ATHQLPPKTVVEMLKANELQKVKLFDADARTMDALAGSNTKVMVAIPNDQLQAMNDKDTAKDWVKRNVTRYTFNVGVNIKYVAV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 86 Download |
| MATHQLPPKT VVEMLKANEL QKVKLFDADA RTMDALAGSN TKVMVAIPND QLQAMNDKDT 60 AKDWVKRNVT RYTFNVGVNI KYVAV* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-12 | 7 | 85 | 80 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAD38251.1 | 9e-33 | 1 | 85 | 1 | 85 | AC006193_7 Similar to glucan endo-1,3-beta-glucosidase precursor [Arabidopsis thaliana] |
| GenBank | AAQ90287.1 | 6e-35 | 2 | 85 | 36 | 119 | beta-1,3-glucanase, acidic [Coffea arabica] |
| RefSeq | NP_187051.3 | 1e-33 | 1 | 85 | 40 | 124 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002277003.1 | 6e-34 | 1 | 85 | 32 | 116 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002525445.1 | 3e-35 | 2 | 85 | 31 | 114 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f55_D | 0.00000000007 | 1 | 85 | 8 | 91 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 3f55_C | 0.00000000007 | 1 | 85 | 8 | 91 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 3f55_B | 0.00000000007 | 1 | 85 | 8 | 91 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 3f55_A | 0.00000000007 | 1 | 85 | 8 | 91 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 3em5_D | 0.00000000007 | 1 | 85 | 8 | 91 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DB689805 | 85 | 1 | 85 | 9e-39 |
| DB709890 | 85 | 1 | 85 | 1e-38 |
| BI178428 | 84 | 1 | 84 | 2e-38 |
| CN214319 | 85 | 1 | 85 | 3e-38 |
| AW617731 | 85 | 1 | 85 | 3e-38 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |