y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10021192
FamilyGH1
Protein PropertiesLength: 402 Molecular Weight: 45989.8 Isoelectric Point: 6.3445
ChromosomeChromosome/Scaffold: 11 Start: 391682 End: 395019
Descriptionbeta glucosidase 32
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11642802.1e-36
  SATEPYIVSHHQLLAHSAAYHLYKNKYRNLTGEIGITYVSHWFLPYSNATEDIDAAHRAQDWMYGWYMDPITYGYYPRTMVDLLGSRLPKFTLEESRLLR
  KSYDFLGINYYTRLSEK
Full Sequence
Protein Sequence     Length: 402     Download
MALQIVVMMF LLAAGISEFV MISADPIPSI DPCSTSNYLY KPSKELPHGR YSFPPGFIFG    60
TATSSFQIEG ASGFAYGKGP SIWDRFTHRY PDRILEGGNG DVAIDHYHKY KEGIKFYHDL    120
LDELIKNGIE PFVTIWHWDT PQALEAEYGG FLSRDIIAFK LGNSATEPYI VSHHQLLAHS    180
AAYHLYKNKY RNLTGEIGIT YVSHWFLPYS NATEDIDAAH RAQDWMYGWY MDPITYGYYP    240
RTMVDLLGSR LPKFTLEESR LLRKSYDFLG INYYTRLSEK DNDTQTLAEA LHDKMRIDFY    300
NSHLTSVLQA INETQVNVKG FFAWSFADNF EWNEGYTVRF GLYYVNYTDL SRHPKDSACW    360
YTNFCNKTQP KTKNLSTKFD LDQLITTSAA PEGLSPSAGR L*                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2723BglB1.0e-1829236171+
pfam00232Glyco_hydro_15.0e-2428936881+
COG2723BglB4.0e-5950276304+
pfam00232Glyco_hydro_11.0e-7652286310+
TIGR03356BGL8.0e-9254361433+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAF34650.1013921536AF221526_1 prunasin hydrolase isoform PHA precursor [Prunus serotina]
GenBankAAL07435.10313921510AF413214_1 prunasin hydrolase isoform PH A precursor [Prunus serotina]
EMBLCAN72287.105036732437hypothetical protein [Vitis vinifera]
RefSeqXP_002285582.105027535346PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285582.12e-21277367419509PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B03827519342A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ptq_B2e-20277367415505A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ptq_A03827519342A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ptq_A2e-20277367415505A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB3ptm_B03827519342A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG06187927511860
HO809497317462750
JG0758031202773960
JG075803322232547e-20
JG075803382462837e-20