| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10023364 |
| Family | GH28 |
| Protein Properties | Length: 140 Molecular Weight: 14875.2 Isoelectric Point: 8.2183 |
| Chromosome | Chromosome/Scaffold: 98 Start: 741160 End: 741579 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH28 | 2 | 111 | 1e-30 |
| VTNLTCGPGHGTSIGSLGKYPDEKCVKNVIVKNGTLTDTDNVGVSIKLWPNLFPGEASDVHFKDIIMNKVNNPIIIDQTCCPGHTCGANRIASKVKINNV VFKNIKGTSK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 140 Download |
| MVTNLTCGPG HGTSIGSLGK YPDEKCVKNV IVKNGTLTDT DNVGVSIKLW PNLFPGEASD 60 VHFKDIIMNK VNNPIIIDQT CCPGHTCGAN RIASKVKINN VVFKNIKGTS KNPDGEFMAE 120 FMTTDGFTTM KIVIIGGSS* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02218 | PLN02218 | 2.0e-19 | 2 | 110 | 109 | + polygalacturonase ADPG | ||
| PLN02155 | PLN02155 | 6.0e-23 | 1 | 110 | 110 | + polygalacturonase | ||
| PLN02793 | PLN02793 | 2.0e-26 | 2 | 110 | 109 | + Probable polygalacturonase | ||
| pfam00295 | Glyco_hydro_28 | 3.0e-31 | 2 | 114 | 113 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. | ||
| PLN02188 | PLN02188 | 3.0e-32 | 2 | 113 | 114 | + polygalacturonase/glycoside hydrolase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004650 | polygalacturonase activity |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| DDBJ | BAA89476.1 | 3e-34 | 2 | 113 | 232 | 341 | polygalacturonase [Salix gilgiana] |
| DDBJ | BAA89477.1 | 4e-34 | 2 | 113 | 232 | 341 | polygalacturonase [Salix gilgiana] |
| DDBJ | BAA89478.1 | 4e-34 | 2 | 113 | 232 | 341 | polygalacturonase [Salix gilgiana] |
| DDBJ | BAA89479.1 | 5e-34 | 2 | 113 | 232 | 341 | polygalacturonase [Salix gilgiana] |
| RefSeq | XP_002329175.1 | 3e-34 | 2 | 132 | 232 | 357 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1ib4_B | 0.0006 | 7 | 79 | 198 | 267 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ib4_A | 0.0006 | 7 | 79 | 198 | 267 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 1ia5_A | 0.0006 | 7 | 79 | 198 | 267 | A Chain A, Polygalacturonase From Aspergillus Aculeatus |
| PDB | 1nhc_F | 0.003 | 3 | 109 | 189 | 291 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| PDB | 1nhc_E | 0.003 | 3 | 109 | 189 | 291 | A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| HS262336 | 133 | 2 | 134 | 6e-36 |
| HS017114 | 133 | 2 | 134 | 6e-36 |
| DY660034 | 109 | 2 | 110 | 1e-35 |
| EH737205 | 109 | 2 | 110 | 5e-35 |
| EL485154 | 110 | 2 | 111 | 7e-35 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |