y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10023368
FamilyAA7
Protein PropertiesLength: 274 Molecular Weight: 30942.1 Isoelectric Point: 8.9468
ChromosomeChromosome/Scaffold: 98 Start: 750256 End: 751770
DescriptionFAD-binding Berberine family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7632108.40779e-45
  HAFAAGVCPSLGAEGHISGGGYGNMIRKFGLSVDNVVDAQIINAKGDLLDRKSMGEDLFWAIRGGGGASFGVIMAWKIKLVKVPERVTVFKVERNVEQGL
  TLLVVKYQEIAPKFESELFLRAFFSTEKVNGTEKGSNATMTVKGKFMA
Full Sequence
Protein Sequence     Length: 274     Download
MSSLPLFYVG DIYTLQVCYA FLLYHFNRLI MLTSYINYYI HITSLLHYCY LIIISIPEKS    60
NVHAFAAGVC PSLGAEGHIS GGGYGNMIRK FGLSVDNVVD AQIINAKGDL LDRKSMGEDL    120
FWAIRGGGGA SFGVIMAWKI KLVKVPERVT VFKVERNVEQ GLTLLVVKYQ EIAPKFESEL    180
FLRAFFSTEK VNGTEKGSNA TMTVKGKFMA QYLGEPDKLL TLIKTQFPEL GILPTDCTPM    240
RWVDTTLYWY RMPNDTKIDY LIQRASKYQS YLK*                                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01565FAD_binding_40.00026311250+
COG0277GlcD2.0e-1077196128+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002317074.1052273142358predicted protein [Populus trichocarpa]
RefSeqXP_002317086.1056273155368predicted protein [Populus trichocarpa]
RefSeqXP_002330565.1056273160372predicted protein [Populus trichocarpa]
RefSeqXP_002523152.1056273140351Reticuline oxidase precursor, putative [Ricinus communis]
RefSeqXP_002523155.1055273156369Reticuline oxidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vte_A056249135327A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_B7.00649e-4364273144338A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_A7.00649e-4364273144338A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsh_A7.00649e-4364273144338A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity
PDB4dns_B1.99965e-4256273138339A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Transmembrane Domains
StartEnd
426
3557
121143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC886624218562730
JG723844218562730
FC896533218562730
DY262774222522730
AJ775742202632640
Orthologous Group
SpeciesID
Arabidopsis lyrata880898
Brachypodium distachyonBradi3g35230.1Bradi5g02950.1
Brassica rapaBra027552
Citrus sinensisorange1.1g037020morange1.1g019526m
Eucalyptus grandisEucgr.D01624.1
Glycine maxGlyma15g14090.2
Linum usitatissimumLus10031080
Manihot esculentacassava4.1_008891m
Medicago truncatulaAC233560_1010.1.205.310AC233560_1010.1.205.310
Oryza sativaLOC_Os10g21690.1
Panicum virgatumPavirv00001111m
Phaseolus vulgarisPhvul.002G201300.1
Setaria italicaSi006831m
Sorghum bicolorSb10g021666.1
Vitis viniferaGSVIVT01021720001.517.648GSVIVT01020745001GSVIVT01021720001.517.648GSVIVT01015803001GSVIVT01021734001
GSVIVT01021720001.63.170GSVIVT01021720001.63.170GSVIVT01021736001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny