y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10023878
FamilyGH13
Protein PropertiesLength: 1143 Molecular Weight: 130632 Isoelectric Point: 6.24
ChromosomeChromosome/Scaffold: 177 Start: 321623 End: 334279
Descriptionstarch branching enzyme 2.1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH136259451.9e-29
  LPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGLVVLMDIVHSHSSNNTLDGLNMFDGTDSQYFHSGARGHHMMWD
  SRLFNYGSWEVVRYLLSNARWWLDEYKFDGFRFDGVTSMMYTHHGLQMTFTGNYNEYFGFATDVDAVVYLMLVNDLIHGLFPEAITIGEDVSGMPTFCIP
  VQDGGVGFDYRLHMAIADKWIELLKKRDEDWRMGDIVHTLTNRRWLEKCVCYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPATPLIDRGIALHKMIR
  LITLGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 1143     Download
MDLVELNPLR DALVGLPGVD GLSTEQRKRL TIAVELVANP SIIFMDEPTS GLDARAAAIV    60
MRTVRNTVDT GRTVVCTIHQ PSIDIFEAFD ELLLMKRGGQ VIYAGPLGRQ SHKLVEYFEA    120
VLGVPKIKDG YNPATWMLEV SSPAMEVQLD VDFAQIYANS TLYHQNQELI KELSTAEPGS    180
KDLYFPTQYS QSFTTQYRAC FWKQNWSYWR NTQYNAVRFF LTFVIGVLFG IIFWKKGQKT    240
GKQQDLMNIL GAIYAAVFFL GATNASSVQP VVSVERTVFY RERAAGMYSA LPYAFAQVSI    300
EAIYVAFQTL IYHLLLYSMI GFEWKVDKFL LFYYYIYMAF VYFTLYGMMV VALTPGHQIA    360
AICMSFFLSF WNLFAGFLIP RIALYKIPES STMVDGKNNR ILGKQGENAV LPDRRFTIGE    420
RSIPPPGAGQ RIYDIDPTLS GFRQHLDYRY SQYKRIRAEI DKFEGGLEEF SRGYEKFGFI    480
RSETGITYRE WAPGATRAAL IGDFNNWNPN ADVMTRNEFG VWEIFLPNNA DGSSPIPHGS    540
RVKIRMDTPS GLKDSIPAWI KFAVQAPGEI PYNGIYYDPP KEEKYVFKHP QPDKPKSLRI    600
YESHVGMSST EPKINTYASF RDDVLPRIKK LGYNAVQIMA IQEHSYYASF GYHVTNFFAP    660
SSRFGTPDDL KSLIDKAHEL GLVVLMDIVH SHSSNNTLDG LNMFDGTDSQ YFHSGARGHH    720
MMWDSRLFNY GSWEVVRYLL SNARWWLDEY KFDGFRFDGV TSMMYTHHGL QMTFTGNYNE    780
YFGFATDVDA VVYLMLVNDL IHGLFPEAIT IGEDVSGMPT FCIPVQDGGV GFDYRLHMAI    840
ADKWIELLKK RDEDWRMGDI VHTLTNRRWL EKCVCYAESH DQALVGDKTI AFWLMDKDMY    900
DFMALDRPAT PLIDRGIALH KMIRLITLGL GGEGYLNFMG NEFGHPEWID FPRGDQHLPN    960
GKVVPGNNNS FDKCRRRFDL GDAEYLRYHG LQEFDQAMHH LEGTYGFMTD IHQYISRKDE    1020
GDRVIVFERG NLVFVFNFHW NQSYSDYRVG CYKSGKYKIV LDSDDALFGG FNRIDHNAEF    1080
FTFDDWYDDR PRSFMVYAPA RTAVVYALVE DTTGKAPVKT ESTVALVNDN LKPLPASETT    1140
HS*                                                                  1200
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03140PLN031401.0e-146381407+
PLN02447PLN0244703781111739+
cd11321AmyAc_bac_euk_BE0582996416+
PLN03140PLN0314001389389+
PLN02960PLN0296005361109578+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0016020membrane
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN05322.104211111136826starch branching enzyme II [Populus trichocarpa]
DDBJBAA82348.204231135158867starch branching enzyme [Phaseolus vulgaris]
EMBLCAA56319.104231124159859starch branching enzyme I [Pisum sativum]
RefSeqXP_002326414.10421111133723predicted protein [Populus trichocarpa]
RefSeqXP_002534111.103891111113839starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0432111113695A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0432111113695A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0432111113695A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A0432111113695A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB1m7x_D0484107225579A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Transmembrane Domains
StartEnd
215234
249268
289311
331353
366385
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79453671042611350
HO77763865648011350
HO45812339571511090
HO4581232964267140
HO777638474354810.0000000009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)