Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10024032 |
Family | AA6 |
Protein Properties | Length: 152 Molecular Weight: 16369.8 Isoelectric Point: 6.8065 |
Chromosome | Chromosome/Scaffold: 353 Start: 142172 End: 142820 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 1 | 151 | 0 |
MYGHVELLSRRMKKGVDGVEAVLYRVPETIPNEFLERMKASPKDPSILEITAAAELVEADGVLFGFPTRYGSMAAQMKSFFDSTGQLWKEQKIAGKPAGF FVSTGTQGGGQETTAWTAITQLAHHGMLFVPVGYTFGAGMFNMESIRGGSP |
Full Sequence |
---|
Protein Sequence Length: 152 Download |
MYGHVELLSR RMKKGVDGVE AVLYRVPETI PNEFLERMKA SPKDPSILEI TAAAELVEAD 60 GVLFGFPTRY GSMAAQMKSF FDSTGQLWKE QKIAGKPAGF FVSTGTQGGG QETTAWTAIT 120 QLAHHGMLFV PVGYTFGAGM FNMESIRGGS P* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00258 | Flavodoxin_1 | 0.001 | 1 | 126 | 139 | + Flavodoxin. | ||
pfam03358 | FMN_red | 6.0e-12 | 18 | 134 | 117 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 1.0e-21 | 1 | 151 | 160 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 5.0e-35 | 1 | 151 | 154 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 1.0e-41 | 1 | 151 | 154 | + NAD(P)H:quinone oxidoreductase; Provisional |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0009055 | electron carrier activity |
GO:0016491 | oxidoreductase activity |
GO:0050662 | coenzyme binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002273030.1 | 0 | 1 | 151 | 65 | 217 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002280986.1 | 0 | 1 | 151 | 59 | 212 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002310794.1 | 0 | 1 | 151 | 63 | 215 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002327699.1 | 0 | 1 | 151 | 62 | 214 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002525103.1 | 0 | 1 | 151 | 66 | 218 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 5e-37 | 1 | 151 | 11 | 159 | A Chain A, Crystal Structure Of Human Glcat-P Apo Form |
PDB | 3b6m_A | 5e-37 | 1 | 151 | 11 | 159 | A Chain A, Crystal Structure Of Human Glcat-P Apo Form |
PDB | 3b6k_B | 5e-37 | 1 | 151 | 11 | 159 | A Chain A, Crystal Structure Of Human Glcat-P Apo Form |
PDB | 3b6k_A | 5e-37 | 1 | 151 | 11 | 159 | A Chain A, Crystal Structure Of Human Glcat-P Apo Form |
PDB | 3b6j_B | 5e-37 | 1 | 151 | 11 | 159 | A Chain A, Crystal Structure Of Human Glcat-P Apo Form |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JG200347 | 152 | 1 | 152 | 0 |
HS253613 | 154 | 1 | 151 | 0 |
HS008391 | 154 | 1 | 151 | 0 |
GD254702 | 154 | 1 | 151 | 0 |
JG500214 | 154 | 1 | 151 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|