| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10024079 |
| Family | GT37 |
| Protein Properties | Length: 141 Molecular Weight: 15859.1 Isoelectric Point: 8.2123 |
| Chromosome | Chromosome/Scaffold: 353 Start: 418128 End: 418550 |
| Description | fucosyltransferase 2 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT37 | 1 | 101 | 9.99967e-42 |
| MYSNKPTVTGEVIRFYQPSHEETQKFKDSDHNIKALVEIYLLSMCEKLVISSKSTFGYVAQGLGDTKAWVLRRPGDGASDPCVRDLSPDPCFHYPPTRSC N | |||
| Full Sequence |
|---|
| Protein Sequence Length: 141 Download |
| MYSNKPTVTG EVIRFYQPSH EETQKFKDSD HNIKALVEIY LLSMCEKLVI SSKSTFGYVA 60 QGLGDTKAWV LRRPGDGASD PCVRDLSPDP CFHYPPTRSC NVGSNKNNNR YVDVADHVPY 120 MKHCKDQKIG VKLVDIHKEL * 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd11548 | NodZ_like | 9.0e-5 | 12 | 65 | 54 | + Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes. | ||
| pfam03254 | XG_FTase | 8.0e-49 | 1 | 100 | 102 | + Xyloglucan fucosyltransferase. Plant cell walls are crucial for development, signal transduction, and disease resistance in plants. Cell walls are made of cellulose, hemicelluloses, and pectins. Xyloglucan (XG), the principal load-bearing hemicellulose of dicotyledonous plants, has a terminal fucosyl residue. This fucosyltransferase adds this residue. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008107 | galactoside 2-alpha-L-fucosyltransferase activity |
| GO:0016020 | membrane |
| GO:0042546 | cell wall biogenesis |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABS70453.1 | 3e-39 | 2 | 140 | 480 | 614 | alpha-1,2-fucosyltransferase [Populus tremula x Populus alba] |
| GenBank | ABS70456.1 | 9e-37 | 1 | 140 | 484 | 619 | alpha-1,2-fucosyltransferase [Populus tremula x Populus alba] |
| RefSeq | XP_002304815.1 | 1e-36 | 1 | 137 | 354 | 486 | glycosyltransferase family-37 [Populus trichocarpa] |
| RefSeq | XP_002304816.1 | 4e-39 | 2 | 140 | 472 | 606 | glycosyltransferase family-37 [Populus trichocarpa] |
| RefSeq | XP_002522474.1 | 3e-36 | 1 | 140 | 443 | 578 | Galactoside 2-alpha-L-fucosyltransferase, putative [Ricinus communis] |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| BE823653 | 136 | 1 | 134 | 2e-38 |
| FS355941 | 139 | 1 | 137 | 3e-38 |
| HO098667 | 143 | 1 | 141 | 6e-38 |
| FR630134 | 143 | 1 | 141 | 6e-38 |
| DB901047 | 143 | 1 | 141 | 7e-38 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
