y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10024922
FamilyAA3
Protein PropertiesLength: 751 Molecular Weight: 81605.7 Isoelectric Point: 7.201
ChromosomeChromosome/Scaffold: 473 Start: 783506 End: 786308
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA32147469.69699e-43
  ETTTYKDETELVESLSKKGVQVTDQQDDILKIECDAVIVGSGCGGGVAAAVLARSGLKVIVLEKGNYFALEDYSSLEGPSLAELYEHGGMLATTNGKTLI
  LAGSTVGGGSAVNWSACIKTPDSVLKEWSQKLPIFGSLEYKEAMDVVWKRLGVTEECKQEGFQNQVLRKGCEKLGLKVDPVSRNSSEDHYCGSCCYGCKT
  GDKKGTDTTWLVDAVENGGLIVTGCKAERFVLQNDESGKRKRCLGVIARSSNPKLSNKTLMIEAQVTVSACGALLTPPLMISSGLNNPNIGKNLHLHPVL
  MAWGYFPESSDLKGKVYEGGIITSIHKVVTEESSNTTIAIIETSSLGPACYAAIFPWTSGLELKEKMIKYPRTAVLFALVRDVGSGQVKVEGRVSHRLDK
  VDKENLRTGLRQALRILVAAGAAEVGTLRSDGQRFQCEGTKEKDFEAFIDGVGVTGGLKSGDNHWTMFSSAHQMGSCRMGETEEDGGVDENGESWEAKGL
  FVCDACVLPSAVGVNPMITIQSTAFCIANKIAA
Full Sequence
Protein Sequence     Length: 751     Download
MEEETECHTL LRGGRRSNGG SYSHGLGSGQ IQSLSAICEA LIPPLTLPEK NTSTVIPLDS    60
QHQQKKQALV AFYGASGSQP PIPHEVAEIM VKRGLSEGVL VVKLVLKMLS FRLGTLLLCG    120
FCSLDWKWPF LHNFSEISID KRQQLLRKWS EEKLIIPLRV VFAFIKFFCL FFFFSRVDEG    180
MKNPSWEAIG YEVDSRKTQC KQKGDRPLQK GIVETTTYKD ETELVESLSK KGVQVTDQQD    240
DILKIECDAV IVGSGCGGGV AAAVLARSGL KVIVLEKGNY FALEDYSSLE GPSLAELYEH    300
GGMLATTNGK TLILAGSTVG GGSAVNWSAC IKTPDSVLKE WSQKLPIFGS LEYKEAMDVV    360
WKRLGVTEEC KQEGFQNQVL RKGCEKLGLK VDPVSRNSSE DHYCGSCCYG CKTGDKKGTD    420
TTWLVDAVEN GGLIVTGCKA ERFVLQNDES GKRKRCLGVI ARSSNPKLSN KTLMIEAQVT    480
VSACGALLTP PLMISSGLNN PNIGKNLHLH PVLMAWGYFP ESSDLKGKVY EGGIITSIHK    540
VVTEESSNTT IAIIETSSLG PACYAAIFPW TSGLELKEKM IKYPRTAVLF ALVRDVGSGQ    600
VKVEGRVSHR LDKVDKENLR TGLRQALRIL VAAGAAEVGT LRSDGQRFQC EGTKEKDFEA    660
FIDGVGVTGG LKSGDNHWTM FSSAHQMGSC RMGETEEDGG VDENGESWEA KGLFVCDACV    720
LPSAVGVNPM ITIQSTAFCI ANKIAASFKK *                                   780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2303BetA1.0e-17267746542+
pfam05199GMC_oxred_C8.0e-19606737132+
pfam00732GMC_oxred_N2.0e-78295512223+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF22878.10227501718alcohol oxidase [Glycine max]
EMBLCAN71289.1067504737hypothetical protein [Vitis vinifera]
EMBLCAP15763.1027504748long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
RefSeqXP_002285334.1067504737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002529832.1017501743electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.00000224774818520A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB3nne_H0.000530873380515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_G0.000530873380515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_F0.000530873380515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
PDB3nne_E0.000530873380515A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant
Transmembrane Domains
StartEnd
155174
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79475375227460
HO7792244442246610
EX2751362944517430
HO8112163274277480
EL8930582914237110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10035673Lus10008239Lus10022903Lus10037257
Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)