y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10025880
FamilyGH9
Protein PropertiesLength: 453 Molecular Weight: 49934.5 Isoelectric Point: 7.8672
ChromosomeChromosome/Scaffold: 605 Start: 797994 End: 799443
Descriptioncellulase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9341830
  NYKDALAKSILFFEGQRSGKLPHSQRMKWRGNSGLSDGSTANVNLVGGYYDAGDNVKFGFPMAFTTTMLSWSVIEFGGMMKDELPHAKQAIRWATDYLLK
  ATNHPDTIYVQVGDANEDHACWERPEDMDTHRTVYKIDKNTPGTEVAGET
GH91844430
  QVCPFYCSYSGYEDELLWAAAWLHRATKLSTYLNYVKANAQSLGADQYDNTFGWDNKHVGARILLSRTFLLRKHADFEDFKDHSDNFVCSIVPGVPNYAS
  QYTPGGLLYKLGDGNMQYVTSTSFLLLAYAKYLAVSGKSVNCGGTVVHAGKLRSIAKRQVDYLLGENPLKMSYMVGYGKKYPLRIHHRGSSLPSIRVKPD
  RIGCSSGYGVMYSQSPNPNVLVGAVVGGPDQGDGFSDQRNDYEHSEPATYINAPLVGSLA
Full Sequence
Protein Sequence     Length: 453     Download
MASSSTVLLL ILPTLITLSL FCFLTSAHPV SRHNYKDALA KSILFFEGQR SGKLPHSQRM    60
KWRGNSGLSD GSTANVNLVG GYYDAGDNVK FGFPMAFTTT MLSWSVIEFG GMMKDELPHA    120
KQAIRWATDY LLKATNHPDT IYVQVGDANE DHACWERPED MDTHRTVYKI DKNTPGTEVA    180
GETQVCPFYC SYSGYEDELL WAAAWLHRAT KLSTYLNYVK ANAQSLGADQ YDNTFGWDNK    240
HVGARILLSR TFLLRKHADF EDFKDHSDNF VCSIVPGVPN YASQYTPGGL LYKLGDGNMQ    300
YVTSTSFLLL AYAKYLAVSG KSVNCGGTVV HAGKLRSIAK RQVDYLLGEN PLKMSYMVGY    360
GKKYPLRIHH RGSSLPSIRV KPDRIGCSSG YGVMYSQSPN PNVLVGAVVG GPDQGDGFSD    420
QRNDYEHSEP ATYINAPLVG SLAYLAHAFG QI*                                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02266PLN02266028452471+
PLN02308PLN02308021447476+
pfam00759Glyco_hydro_9034443462+
PLN03009PLN03009031446465+
PLN02613PLN02613022445471+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_192138.101745235516AtGH9B13 (Arabidopsis thaliana glycosyl hydrolase 9B13); catalytic/ hydrolase, hydrolyzing O-glycosyl compounds
RefSeqXP_002271736.102245223511PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301487.102845240511glycosyl hydrolase family 9 [Populus trichocarpa]
RefSeqXP_002320998.1034524510predicted protein [Populus trichocarpa]
RefSeqXP_002523114.103345245510endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0334453428A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1ksc_A0334453428A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1ks8_A0334453428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0344505445A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0344505445A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES7918322691854530
EV2433042691854530
EX2936042681854480
GO9585442541904430
HO788388398984460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00114.1.21.201Aquca_013_00114.1.21.201Aquca_017_00132.3
Carica papayaevm.model.supercontig_183.4.29.235
Eucalyptus grandisEucgr.E01718.1.36.217Eucgr.E01718.1.36.217
Fragaria vescamrna21629.1-v1.0-hybrid
Linum usitatissimumLus10025880.34.183Lus10025880.34.183Lus10030008
Manihot esculentacassava4.1_004404m.27.206cassava4.1_004404m.27.206cassava4.1_023568m
Medicago truncatulaMedtr5g093590.1.34.150Medtr5g093590.1.34.150
Panicum virgatumPavirv00051820m
Picea abiesMA_8118797g0010MA_62382g0010MA_10430095g0010.32.209MA_54112g0010.32.180MA_54112g0010.32.180
MA_501421g0010MA_79718g0010MA_169910g0010MA_863320g0010MA_10430095g0010.32.209
MA_10349916g0010.64.241MA_10349916g0010.64.241MA_10241783g0010.37.216MA_10241783g0010.37.216MA_20530g0010.13.192
MA_20530g0010.13.192MA_10694g0010MA_107238g0010.91.354MA_107238g0010.91.354
Populus trichocarpaPotri.014G044400.1Potri.004G161900.1
Ricinus communis30190.m010828
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny