y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10026861
FamilyGH1
Protein PropertiesLength: 196 Molecular Weight: 22741.8 Isoelectric Point: 9.0902
ChromosomeChromosome/Scaffold: 651 Start: 227418 End: 228621
Descriptionbeta glucosidase 42
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1121850
  HGFVGLNHYTSRFIAHVPGGGDEETNFYKAQSMKRIHEWEDGEPIGEKAASEWLYVCPWGLRKVLNYVAKTYKSPKIYITENGMDDEDRDAPLEEMLDDK
  MRVRYFEGYLKAVAEAIRDGVHVKGYFAWSLLDNFEWAQGYTKRFGIVYVDYNDGKLTRHPKSSAYWFLRPLRK
Full Sequence
Protein Sequence     Length: 196     Download
MPASPVRASK HHGFVGLNHY TSRFIAHVPG GGDEETNFYK AQSMKRIHEW EDGEPIGEKA    60
ASEWLYVCPW GLRKVLNYVA KTYKSPKIYI TENGMDDEDR DAPLEEMLDD KMRVRYFEGY    120
LKAVAEAIRD GVHVKGYFAW SLLDNFEWAQ GYTKRFGIVY VDYNDGKLTR HPKSSAYWFL    180
RPLRKRHKAR TELSQ*                                                    240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029981.0e-2869179111+
COG2723BglB1.0e-3214179168+
PRK13511PRK135111.0e-347179182+
TIGR03356BGL2.0e-4614179168+
pfam00232Glyco_hydro_12.0e-4814179166+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAP51059.1014184312480latex cyanogenic beta glucosidase [Hevea brasiliensis]
EMBLCBI23349.1014184159327unnamed protein product [Vitis vinifera]
RefSeqXP_002265653.1014184146314PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270406.10141848491017PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002514775.1014184314490beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B014185335505A Chain A, Peanut Peroxidase
PDB3ptq_A014185335505A Chain A, Peanut Peroxidase
PDB3ptm_B014185335505A Chain A, Peanut Peroxidase
PDB3ptm_A014185335505A Chain A, Peanut Peroxidase
PDB3ptk_B014185335505A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG267673171141840
JG243160149361840
JG233765145401840
JG089858141441840
JG031921142431840
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.124evm.model.supercontig_88.6
Capsella rubellaCarubv10019488m
Fragaria vescamrna00446.1-v1.0-hybrid
Glycine maxGlyma08g15960.3.242.369Glyma08g15960.3.242.369
Linum usitatissimumLus10030515.313.435Lus10020500Lus10020234Lus10030515.313.435
Malus domesticaMDP0000196383MDP0000151948MDP0000292674MDP0000201747.130.258MDP0000201747.130.258
MDP0000205601.303.434MDP0000205601.303.434MDP0000716537
Manihot esculentacassava4.1_028771m.269.395cassava4.1_028771m.269.395cassava4.1_030081m
Panicum virgatumPavirv00007277mPavirv00051180m
Picea abiesMA_10427912g0010MA_10330649g0010MA_10432745g0010
Populus trichocarpaPotri.011G130200.1Potri.001G223200.1
Vitis viniferaGSVIVT01032009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny