y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10031080
FamilyAA7
Protein PropertiesLength: 324 Molecular Weight: 35456.2 Isoelectric Point: 8.3475
ChromosomeChromosome/Scaffold: 261 Start: 1068147 End: 1069118
DescriptionFAD-binding Berberine family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7622490
  SGGHDYEGRSYTSDHSPFFILDMCNLRSIHVDIQSQTAWVECGATLGEFFHAIAGKSPTHAFPAGVCPTVGVGRHGGYGNLMRKYGLSIDHIVDAKGNVL
  NRESMREDLFWAIRGGGATFGVFLSYKVNLVNVPEVVTVFRIWRTLEDNATEMVYTWQKVAPTASVDLFIRLVLDVVTTSVKKHKTAR
Full Sequence
Protein Sequence     Length: 324     Download
MPTSTTSASP PHQPQSPSSS SPHPTIPTSV QPSSPPPPTP TSPSRTGAAR APPHVDNRNT    60
ASGGHDYEGR SYTSDHSPFF ILDMCNLRSI HVDIQSQTAW VECGATLGEF FHAIAGKSPT    120
HAFPAGVCPT VGVGRHGGYG NLMRKYGLSI DHIVDAKGNV LNRESMREDL FWAIRGGGAT    180
FGVFLSYKVN LVNVPEVVTV FRIWRTLEDN ATEMVYTWQK VAPTASVDLF IRLVLDVVTT    240
SVKKHKTARA TFIGMFLGRS VRLMSIMREK FLEVGLTASD CVEMSWINTV AFWADKSEVT    300
KTRTEMEEVM WSGSREGRRD PTT*                                           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0277GlcD5.0e-581183118+
pfam01565FAD_binding_44.0e-1062162110+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN60572.102829573350hypothetical protein [Vitis vinifera]
EMBLCAN80091.1062295109350hypothetical protein [Vitis vinifera]
RefSeqXP_002269462.1062295109350PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002270181.1062295109350PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002523152.10429515329Reticuline oxidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3tsj_B02729248313A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3tsj_A02729248313A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3tsh_A02729248313A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity
PDB4dns_B06229285315A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB4dns_A06229285315A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JK988562238622900
GR097526247663030
GT085022242622930
GW865097241763060
EG693474184622370
Orthologous Group
SpeciesID
Arabidopsis lyrata880898
Brachypodium distachyonBradi3g35230.1Bradi5g02950.1
Brassica rapaBra027552
Citrus sinensisorange1.1g037020morange1.1g019526m
Eucalyptus grandisEucgr.D01624.1
Glycine maxGlyma15g14090.2
Linum usitatissimumLus10023368
Manihot esculentacassava4.1_008891m
Medicago truncatulaAC233560_1010.1.205.310AC233560_1010.1.205.310
Oryza sativaLOC_Os10g21690.1
Panicum virgatumPavirv00001111m
Phaseolus vulgarisPhvul.002G201300.1
Setaria italicaSi006831m
Sorghum bicolorSb10g021666.1
Vitis viniferaGSVIVT01021720001.517.648GSVIVT01020745001GSVIVT01021720001.517.648GSVIVT01015803001GSVIVT01021734001
GSVIVT01021720001.63.170GSVIVT01021720001.63.170GSVIVT01021736001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny