| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10031296 |
| Family | PL1 |
| Protein Properties | Length: 130 Molecular Weight: 14614.5 Isoelectric Point: 9.0963 |
| Chromosome | Chromosome/Scaffold: 977 Start: 1028037 End: 1028499 |
| Description | Pectin lyase-like superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| PL1 | 2 | 123 | 0 |
| DGDAVRLVTAHKVRIDHNTLYSCQDGLLDVTRGSTDVTVFNNWFRNQDKVMLLGHDDGYVRDKGMKVTVLLNHFGPNCNQRMPRVRHGYAHVANNLYQGW TQYAIGGSMNPSIKSESNYFIA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 130 Download |
| MDGDAVRLVT AHKVRIDHNT LYSCQDGLLD VTRGSTDVTV FNNWFRNQDK VMLLGHDDGY 60 VRDKGMKVTV LLNHFGPNCN QRMPRVRHGY AHVANNLYQG WTQYAIGGSM NPSIKSESNY 120 FIAPTGRKE* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3866 | PelB | 8.0e-21 | 4 | 121 | 130 | + Pectate lyase [Carbohydrate transport and metabolism] | ||
| pfam00544 | Pec_lyase_C | 6.0e-45 | 2 | 121 | 128 | + Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue. | ||
| smart00656 | Amb_all | 3.0e-49 | 1 | 124 | 133 | + Amb_all domain. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI26401.1 | 0 | 1 | 129 | 118 | 247 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_196490.1 | 0 | 1 | 129 | 118 | 247 | pectate lyase family protein [Arabidopsis thaliana] |
| RefSeq | XP_002299118.1 | 0 | 1 | 129 | 149 | 279 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002304865.1 | 0 | 1 | 129 | 149 | 278 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002527354.1 | 0 | 1 | 129 | 177 | 305 | Major pollen allergen Jun v 1 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1pxz_B | 9.80909e-45 | 2 | 125 | 149 | 272 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 1pxz_A | 9.80909e-45 | 2 | 125 | 149 | 272 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 1jta_A | 0.00000000000005 | 11 | 121 | 152 | 287 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 1jrg_B | 0.00000000000005 | 11 | 121 | 152 | 287 | A Chain A, Crystal Structure Of The R3 Form Of Pectate Lyase A, Erwinia Chrysanthemi |
| PDB | 1jrg_A | 0.00000000000005 | 11 | 121 | 152 | 287 | A Chain A, Crystal Structure Of The R3 Form Of Pectate Lyase A, Erwinia Chrysanthemi |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DT575750 | 130 | 1 | 129 | 0 |
| FD757999 | 130 | 1 | 129 | 0 |
| FG470156 | 129 | 2 | 129 | 0 |
| FG468822 | 129 | 2 | 129 | 0 |
| FG468635 | 129 | 2 | 129 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |