y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10031992
FamilyGT29
Protein PropertiesLength: 468 Molecular Weight: 53229.8 Isoelectric Point: 8.5248
ChromosomeChromosome/Scaffold: 42 Start: 431192 End: 434282
DescriptionMALE GAMETOPHYTE DEFECTIVE 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT291553502.99878e-43
  KCYNRSLCEEHLNLILPAKPPFHPQQFRTCAVVGNSGDLLKTEFGEEIDGHDVVIRDNEAPVNQKYAKHVGLKRDFRLVVRGAAANMVKILEGSDDEVLI
  IKSVVHRDFNALIKTIPNPVYLFQGIVLRRGAKGTGMKSIELALSMCETVDIYGFTVDPGYTEWTRYFSTPRKGHNPLQGRAYYQLLECLGVIRIH
Full Sequence
Protein Sequence     Length: 468     Download
MRPQKNASSR LPSVFHLVWV AAFFSLFIFI IFQSTFFSGN KRTDQKTEED IRTLSQFQSE    60
VQQCVANRGL GLTALITDHC KLTLKFPEDT NSTWFNAQFK VFEALEFPYD VCDTIMLWEQ    120
YRNMTTVLTR EYLDARPDGW FDYAAKRIAQ LGADKCYNRS LCEEHLNLIL PAKPPFHPQQ    180
FRTCAVVGNS GDLLKTEFGE EIDGHDVVIR DNEAPVNQKY AKHVGLKRDF RLVVRGAAAN    240
MVKILEGSDD EVLIIKSVVH RDFNALIKTI PNPVYLFQGI VLRRGAKGTG MKSIELALSM    300
CETVDIYGFT VDPGYTEWTR YFSTPRKGHN PLQGRAYYQL LECLGVIRIH SPMRAQRKQD    360
WADVPSRETV SSTHAAAMRL KFREAAGLGQ FGKCKVWGHR DAKGNGPISG SPDMTDVRKN    420
SNYSKWETLP FESLRREAQD HNSQMEGVSL YKMDGNKLDD LVCVRPR*                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_292.0e-47142353255+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI21279.1014651470unnamed protein product [Vitis vinifera]
RefSeqNP_850940.1074656467glycosyl transferase family 29 protein / sialyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002275669.101346160508PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002320429.1014651467predicted protein [Populus trichocarpa]
RefSeqXP_002512844.1014461444alpha-2,8-sialyltransferase 8b, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.000000000318232898266A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB2wnb_A0.000000000318232898266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.000000000418233498266A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
1332
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR9147973001094040
CK254085280503290
EY7151712871784640
GE6095572571243800
EX0891532451023460
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00108.5Aquca_019_00142.1Aquca_004_00108.4Aquca_004_00108.3Aquca_004_00108.2
Aquca_004_00108.1
Arabidopsis lyrata906136470934
Arabidopsis thalianaAT3G48820.2AT3G48820.1AT1G08660.1AT1G08660.2
Brachypodium distachyonBradi3g01700.2Bradi3g01700.3Bradi3g01700.1Bradi1g67467.1
Brassica rapaBra019569Bra031637
Carica papayaevm.model.supercontig_4.113evm.model.supercontig_70.73
Capsella rubellaCarubv10017505mCarubv10017208mCarubv10009607mCarubv10009038m
Citrus clementinaCiclev10031577mCiclev10031575mCiclev10031902m
Citrus sinensisorange1.1g013814morange1.1g013792morange1.1g017903morange1.1g017882morange1.1g022244m
orange1.1g019465morange1.1g011883m
Cucumis sativusCucsa.014710.2Cucsa.014710.1Cucsa.156010.2Cucsa.156010.1
Eucalyptus grandisEucgr.F04117.1Eucgr.I01604.1Eucgr.G01933.1
Fragaria vescamrna06450.1-v1.0-hybridmrna01393.1-v1.0-hybrid
Glycine maxGlyma05g34110.1Glyma08g05580.4Glyma08g05580.3Glyma08g05580.1Glyma08g05580.2
Glyma19g27546.1Glyma16g05340.1
Gossypium raimondiiGorai.008G209800.2Gorai.008G209800.1Gorai.005G137400.2Gorai.005G137400.1Gorai.005G137400.3
Linum usitatissimumLus10032547Lus10043193Lus10035162
Malus domesticaMDP0000239581MDP0000149927MDP0000165459MDP0000211019MDP0000304668
MDP0000244138
Manihot esculentacassava4.1_007830mcassava4.1_008832m
Medicago truncatulaMedtr7g084010.1Medtr8g099840.2Medtr8g099840.1
Mimulus guttatusmgv1a023151mmgv1a005647m
Oryza sativaLOC_Os02g02620.1LOC_Os11g36420.1
Panicum virgatumPavirv00016935mPavirv00068699mPavirv00023972mPavirv00062875mPavirv00062874m
Physcomitrella patensPp1s457_24V6.1Pp1s209_60V6.1
Phaseolus vulgarisPhvul.002G327200.1Phvul.001G084900.1
Picea abiesMA_30391g0010MA_932319g0010
Populus trichocarpaPotri.015G104100.1Potri.014G145400.2Potri.014G145400.1
Prunus persicappa005917mppa005273m
Ricinus communis30147.m01442930131.m006986
Setaria italicaSi017190mSi026296m
Selaginella moellendorffii406168831178267676584403717
760757656779823
Sorghum bicolorSb04g001370.1Sb05g022210.1
Thellungiella halophilaThhalv10010382mThhalv10007525m
Vitis viniferaGSVIVT01008625001GSVIVT01032992001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)