| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10032039 |
| Family | GH17 |
| Protein Properties | Length: 116 Molecular Weight: 13010.8 Isoelectric Point: 4.8955 |
| Chromosome | Chromosome/Scaffold: 42 Start: 625976 End: 626323 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 107 | 2.6e-33 |
| MLDEMLDAVYVSMKKLDGRFKDVEIVIGETGWPTVGEPTQPGTGLENAREYNRNVVRHVRSGKGTPLMPNRTFETYIFSLFDENLEIYASDRSFGVFKPD FSAVYDA | |||
| Full Sequence |
|---|
| Protein Sequence Length: 116 Download |
| MLDEMLDAVY VSMKKLDGRF KDVEIVIGET GWPTVGEPTQ PGTGLENARE YNRNVVRHVR 60 SGKGTPLMPN RTFETYIFSL FDENLEIYAS DRSFGVFKPD FSAVYDAGLI RSKPI* 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 5.0e-30 | 1 | 106 | 107 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAN83700.1 | 1e-37 | 1 | 111 | 114 | 223 | hypothetical protein [Vitis vinifera] |
| RefSeq | NP_190241.1 | 3.00004e-41 | 1 | 115 | 238 | 350 | glycosyl hydrolase family 17 protein [Arabidopsis thaliana] |
| RefSeq | XP_002298356.1 | 7.00649e-44 | 1 | 111 | 235 | 343 | glycoside hydrolase [Populus trichocarpa] |
| RefSeq | XP_002530862.1 | 3e-37 | 1 | 113 | 236 | 347 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| RefSeq | XP_002532848.1 | 3.00004e-41 | 1 | 112 | 233 | 342 | Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ur8_B | 5e-23 | 1 | 100 | 210 | 305 | A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate |
| PDB | 3ur8_A | 5e-23 | 1 | 100 | 210 | 305 | A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate |
| PDB | 3ur7_B | 5e-23 | 1 | 100 | 210 | 305 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 3ur7_A | 5e-23 | 1 | 100 | 210 | 305 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 4gzj_A | 3e-22 | 1 | 100 | 210 | 305 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| AM726542 | 114 | 1 | 114 | 0 |
| AM732895 | 114 | 1 | 114 | 0 |
| DT512949 | 112 | 1 | 112 | 4.2039e-45 |
| DR462835 | 113 | 1 | 113 | 5.60519e-45 |
| DT465235 | 113 | 1 | 113 | 1.96182e-44 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |