Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10033956 |
Family | CBM49 |
Protein Properties | Length: 106 Molecular Weight: 11767.5 Isoelectric Point: 10.1032 |
Chromosome | Chromosome/Scaffold: 292 Start: 123040 End: 123420 |
Description | glycosyl hydrolase 9C3 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM49 | 13 | 90 | 5.1e-39 |
IAIKQKVTTSWNHQGKTYYRYSAIVTNYSPKPLNNIKLYINKLYGPIWGLTKYGNSYGFPAWIKSLPAGKSMEFVYIH |
Full Sequence |
---|
Protein Sequence Length: 106 Download |
MSNFGSISNS APIAIKQKVT TSWNHQGKTY YRYSAIVTNY SPKPLNNIKL YINKLYGPIW 60 GLTKYGNSYG FPAWIKSLPA GKSMEFVYIH TAPYADVSVS TYTLA* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
smart01063 | CBM49 | 8.0e-17 | 15 | 90 | 80 | + Carbohydrate binding domain CBM49. This domain is found at the C terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose. |
PLN02340 | PLN02340 | 5.0e-20 | 11 | 102 | 94 | + endoglucanase |
pfam09478 | CBM49 | 7.0e-29 | 13 | 91 | 80 | + Carbohydrate binding domain CBM49. This domain is found at the C terminal of cellulases and in vitro binding studies have shown it to binds to crystalline cellulose. |
PLN02171 | PLN02171 | 2.0e-44 | 8 | 105 | 98 | + endoglucanase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0005576 | extracellular region |
GO:0030246 | carbohydrate binding |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK96199.1 | 1e-38 | 8 | 104 | 183 | 279 | unknown [Populus trichocarpa] |
DDBJ | BAA21111.1 | 9.99995e-41 | 8 | 105 | 227 | 324 | endo-1,4-beta-glucanase [Gossypium hirsutum] |
EMBL | CAI68020.1 | 2e-36 | 8 | 105 | 523 | 620 | endo-beta-1,4-glucanase [Prunus persica] |
RefSeq | XP_002299478.1 | 2e-36 | 8 | 105 | 525 | 622 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002303645.1 | 6e-37 | 8 | 104 | 525 | 621 | glycosyl hydrolase family 9 [Populus trichocarpa] |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX720055 | 100 | 7 | 106 | 0 |
JG060793 | 100 | 7 | 106 | 0 |
JG242420 | 99 | 8 | 106 | 0 |
GW877716 | 99 | 8 | 106 | 7.00649e-44 |
JG142289 | 97 | 10 | 106 | 5.00264e-43 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |