y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10034515
FamilyGH9
Protein PropertiesLength: 525 Molecular Weight: 56868.9 Isoelectric Point: 5.4559
ChromosomeChromosome/Scaffold: 9 Start: 224641 End: 227012
Descriptionglycosyl hydrolase 9B5
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9565100
  YSNALNVAIQFFDVQKAGKLNEDKIKWRGDSALDDGSAAKLDLSKGLYDAGDHMKFGFPMAFTATVLSWSILEYGDQMEAANQLATAQDSLKWITDFLIQ
  AHPSDNVLYVQVGDPVADHKCWNRPEDMTEKRPVFQVNASFPGSDVAAEAAAAMASASLVFKKKDSDYSNTLLKHAKQLFSFADKYKGSYCDSIPGSATY
  YNSTGYGDELLWAASWLYHATGDKSYLQYVTGQNGNDFGDWGNPTWFSWDNKLPGTHVLLARLTLLGDKDTSNAGLQQYRETAEAVMCGLIPDSPTATSS
  RTDGGLIWVSDWNALQQPVAAAFLASVYSDYMLTSGKRKFSCSGSTFKSSDLKKFARSQADYVLGDNPMKMSYLVGYGDKYPQFVHHRGASIPDDASTGC
  SDGWKWLESKDPNPNVAMGALVGGPFKNDSFIDDRNNTMQTEPSTYNSAVMVGLL
Full Sequence
Protein Sequence     Length: 525     Download
MGKKGGCGFV GWFLVLVILG LLAGGIFLVM RSKMHKSGDE DGGSVPGSPG QIQKKYSNAL    60
NVAIQFFDVQ KAGKLNEDKI KWRGDSALDD GSAAKLDLSK GLYDAGDHMK FGFPMAFTAT    120
VLSWSILEYG DQMEAANQLA TAQDSLKWIT DFLIQAHPSD NVLYVQVGDP VADHKCWNRP    180
EDMTEKRPVF QVNASFPGSD VAAEAAAAMA SASLVFKKKD SDYSNTLLKH AKQLFSFADK    240
YKGSYCDSIP GSATYYNSTG YGDELLWAAS WLYHATGDKS YLQYVTGQNG NDFGDWGNPT    300
WFSWDNKLPG THVLLARLTL LGDKDTSNAG LQQYRETAEA VMCGLIPDSP TATSSRTDGG    360
LIWVSDWNAL QQPVAAAFLA SVYSDYMLTS GKRKFSCSGS TFKSSDLKKF ARSQADYVLG    420
DNPMKMSYLV GYGDKYPQFV HHRGASIPDD ASTGCSDGWK WLESKDPNPN VAMGALVGGP    480
FKNDSFIDDR NNTMQTEPST YNSAVMVGLL SGLVATSSVV ESLA*                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00119PLN001193.0e-15450513470+
PLN02340PLN023404.0e-15956518470+
PLN02171PLN021713.0e-15956515468+
pfam00759Glyco_hydro_97.0e-17356511460+
PLN02345PLN02345059524469+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF42037.103352334525cellulase2 [Pyrus communis]
RefSeqXP_002276739.104552344524PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300715.103152332522predicted protein [Populus trichocarpa]
RefSeqXP_002307711.105452353522predicted protein [Populus trichocarpa]
RefSeqXP_002510516.103352434523endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A0565155430A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans
PDB1ksc_A0565155430A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans
PDB1ks8_A0565155430A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B0555145441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A0555145441A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR2182833301915200
GR2182823211915110
HO7820383152145250
ES8173623211224410
EH1885863791425170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00072.3Aquca_007_00072.2Aquca_007_00072.1
Arabidopsis lyrata472218895440
Arabidopsis thalianaAT1G75680.1AT1G19940.1
Brachypodium distachyonBradi4g36240.1Bradi1g35220.1
Brassica rapaBra025783Bra008214Bra015827Bra012198
Carica papayaevm.model.supercontig_26.31evm.model.supercontig_6.239
Capsella rubellaCarubv10020139mCarubv10008868m
Citrus clementinaCiclev10003402mCiclev10000849mCiclev10025306m
Citrus sinensisorange1.1g009846morange1.1g036398morange1.1g048736m
Cucumis sativusCucsa.342940.1
Eucalyptus grandisEucgr.I02356.1Eucgr.F01640.1
Fragaria vescamrna14858.1-v1.0-hybridmrna08501.1-v1.0-hybrid
Glycine maxGlyma02g05510.2Glyma02g05510.1Glyma04g02740.1Glyma06g02760.1Glyma16g23930.2
Gossypium raimondiiGorai.002G123700.1Gorai.009G195400.1Gorai.007G195700.1Gorai.010G005200.1Gorai.009G195400.2
Gorai.009G195400.3Gorai.009G195400.4
Linum usitatissimumLus10025965Lus10033156Lus10014265
Malus domesticaMDP0000140066.57.384MDP0000250849MDP0000140066.57.384MDP0000147635
Manihot esculentacassava4.1_005604mcassava4.1_005517mcassava4.1_005180mcassava4.1_021748m
Medicago truncatulaMedtr8g075990.1Medtr3g113720.1
Mimulus guttatusmgv1a004472mmgv1a004578m
Oryza sativaLOC_Os09g36350.2LOC_Os06g50140.1LOC_Os09g36350.1
Panicum virgatumPavirv00061954mPavirv00002469mPavirv00006523mPavirv00002468m
Physcomitrella patensPp1s308_21V6.1Pp1s60_116V6.1
Phaseolus vulgarisPhvul.009G016100.1Phvul.003G262600.1
Picea abiesMA_132273g0020
Populus trichocarpaPotri.005G115400.1Potri.005G237700.1Potri.002G023900.1
Ricinus communis30170.m01379027471.m000417
Setaria italicaSi006241mSi029476m
Selaginella moellendorffii77612144066
Sorghum bicolorSb10g030140.1Sb02g030990.1
Thellungiella halophilaThhalv10007364mThhalv10018397m
Vitis viniferaGSVIVT01018793001GSVIVT01009881001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny