CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10035600
FamilyCE16
Protein PropertiesLength: 371 Molecular Weight: 40756.8 Isoelectric Point: 9.4835
ChromosomeChromosome/Scaffold: 464 Start: 534858 End: 537349
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE16433526.6e-22
  LFVFGDSYADTGNVRKALATSWKLPYGITFPGRPAGRFSDGRVLTDFLARFIGVKSPIPYKWRKVGPKSVRYGMNFAFGGTGVFNTLSPEPNMTTQIDLL
  QQMLTQKTYSTFDLHNSVALVSVAGNDYSTYLSTNGSLEDLPAFISQVVNQTTKNLLRIQGMGIKKVVVTGLPPLGCLPATTSFNMFQQCNDSQNQLVTL
  HNFLLRQSIADLNPNNNDTKFMLLDMFQAFMTILDQKPAKEQTTTTSSSSSSSSGKGKLLWNPLKPCCQGMSAGEGCGSVDESTGGKRYTVCEDPKAAFF
  WDSVHPTQEG
Full Sequence
Protein Sequence     Length: 371     Download
MAKITNFCFL LLLFSSFLFL LSVSAAEEGY GQRHLFRFKP SKLFVFGDSY ADTGNVRKAL    60
ATSWKLPYGI TFPGRPAGRF SDGRVLTDFL ARFIGVKSPI PYKWRKVGPK SVRYGMNFAF    120
GGTGVFNTLS PEPNMTTQID LLQQMLTQKT YSTFDLHNSV ALVSVAGNDY STYLSTNGSL    180
EDLPAFISQV VNQTTKNLLR IQGMGIKKVV VTGLPPLGCL PATTSFNMFQ QCNDSQNQLV    240
TLHNFLLRQS IADLNPNNND TKFMLLDMFQ AFMTILDQKP AKEQTTTTSS SSSSSSGKGK    300
LLWNPLKPCC QGMSAGEGCG SVDESTGGKR YTVCEDPKAA FFWDSVHPTQ EGWRAVTFAL    360
KSNLLSGLMI * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01847Triacylglycerol_lipase_like1.0e-640356328+
COG3240COG32409.0e-741356338+
PLN03156PLN031561.0e-2243350338+
cd01846fatty_acyltransferase_like1.0e-3242352313+
cd01837SGNH_plant_lipase_like8.0e-8743356328+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU23785.102836231347unknown [Glycine max]
RefSeqNP_195981.1073699357GDSL-motif lipase/hydrolase family protein [Arabidopsis thaliana]
RefSeqXP_002283113.1043646351PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330395.103536044354predicted protein [Populus trichocarpa]
RefSeqXP_002528712.103536439353carboxylic ester hydrolase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG0267771991733710
JG0491421991733710
DT557753312363470
EX137924322233420
JG723944294333220
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_072_00172.1
Fragaria vescamrna30256.1-v1.0-hybrid
Linum usitatissimumLus10003253
Physcomitrella patensPp1s126_111V6.1
Ricinus communis29625.m000675
Vitis viniferaGSVIVT01033808001GSVIVT01011247001GSVIVT01011220001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny