y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10037257
FamilyAA3
Protein PropertiesLength: 695 Molecular Weight: 76263.4 Isoelectric Point: 7.5271
ChromosomeChromosome/Scaffold: 462 Start: 1018758 End: 1022402
DescriptionLong-chain fatty alcohol dehydrogenase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA31546740
  NTNLPTNTVTDSLQKSGFQVSATTTGTINIKCDAVVVGSGSGGGVVAGMLANAGYKVLVLEKGSYFARNNLSLLEGPSMDQMYLSGGLRATNDMSFVVLA
  GSTVGGGSAINWSASIKTPHKVTKEWSHEYQLELFESKTYREAMEVVCQRMGVHTKVDVVEGLNNAVLRKGCQQLGYPVDDIPRNSDAKHSCGWCCFGCK
  EGRKMGTSETWLVDLVNSGNGVILPGCEAVKVLHESRNGRKIATGAVFESMTKEIFMVESKVTVVACGALSTPPLLRRSGLKNRHIGENLHLHPVTMAWG
  YFPDEEVWKQKSYDGPIMTAMSKVSPEDESEDDDGLYGAIIQTPSLHPGMFSSFMPWVSGSDLKRRMTRFSRTAHIFTLVRDRGSGAVKDCSDNISYEME
  ESDERNLQKGVEKILRILAAAGAEEMGTHNLGGKSINVKEVGSEELERFVKEESRRPIRGLRTQLGSAHQMGSCRMGVDPAVSAVKETGETWEVEGLYVA
  DSSVFPTALGVNPMVTVQAIA
Full Sequence
Protein Sequence     Length: 695     Download
MAGTPQRIGR LVGGRLEHPK IWLVRLALWL LSTWIGTFIL CGRLSISSRF PFLSSFPEIP    60
LETREQIVLS WSQSIFFHLR MLFKAFKLLI PLIFFSQVDE KIENPTWEAI GYPGSDPAYK    120
PEQQHPSNEL LAAAANITTT KEHPYGPLHR GIINTNLPTN TVTDSLQKSG FQVSATTTGT    180
INIKCDAVVV GSGSGGGVVA GMLANAGYKV LVLEKGSYFA RNNLSLLEGP SMDQMYLSGG    240
LRATNDMSFV VLAGSTVGGG SAINWSASIK TPHKVTKEWS HEYQLELFES KTYREAMEVV    300
CQRMGVHTKV DVVEGLNNAV LRKGCQQLGY PVDDIPRNSD AKHSCGWCCF GCKEGRKMGT    360
SETWLVDLVN SGNGVILPGC EAVKVLHESR NGRKIATGAV FESMTKEIFM VESKVTVVAC    420
GALSTPPLLR RSGLKNRHIG ENLHLHPVTM AWGYFPDEEV WKQKSYDGPI MTAMSKVSPE    480
DESEDDDGLY GAIIQTPSLH PGMFSSFMPW VSGSDLKRRM TRFSRTAHIF TLVRDRGSGA    540
VKDCSDNISY EMEESDERNL QKGVEKILRI LAAAGAEEMG THNLGGKSIN VKEVGSEELE    600
RFVKEESRRP IRGLRTQLGS AHQMGSCRMG VDPAVSAVKE TGETWEVEGL YVADSSVFPT    660
ALGVNPMVTV QAIAYCTGLS VLERLRRKKL CSEL*                               720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK02106PRK021062.0e-659766066+
pfam05199GMC_oxred_C6.0e-23547675129+
COG2303BetA7.0e-38203675527+
pfam00732GMC_oxred_N4.0e-71232448222+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI29206.10168575644unnamed protein product [Vitis vinifera]
RefSeqNP_193673.20368939726alcohol oxidase-related [Arabidopsis thaliana]
RefSeqXP_002269629.10168975787PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002328753.10168943745predicted protein [Populus trichocarpa]
RefSeqXP_002519938.1076897709electron carrier, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3t37_A0.000218443417281A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
PDB1kdg_B0.00051864619296A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB1kdg_A0.00051864619296A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB1naa_B0.00051864614291A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB1naa_A0.00051864614291A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
Transmembrane Domains
StartEnd
2140
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8838504672326890
HO794753672236770
JG2413501915056950
HO7792244471656020
EY8046732572024550
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1Phvul.011G136600.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)