| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10037749 |
| Family | GH17 |
| Protein Properties | Length: 73 Molecular Weight: 8008.01 Isoelectric Point: 4.9646 |
| Chromosome | Chromosome/Scaffold: 196 Start: 1382495 End: 1382713 |
| Description | Glycosyl hydrolase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 69 | 2.8e-24 |
| MERLGGWSVEVVVSESGWPSAGAGAATTMDNTRVFYTNLVQQVKRGSPKRPNKAIETYLFAMFDENQKD | |||
| Full Sequence |
|---|
| Protein Sequence Length: 73 Download |
| MERLGGWSVE VVVSESGWPS AGAGAATTMD NTRVFYTNLV QQVKRGSPKR PNKAIETYLF 60 AMFDENQKDP EL* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 7.0e-22 | 19 | 71 | 53 | + Glycosyl hydrolases family 17. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3EM5 | 1e-26 | 1 | 72 | 226 | 296 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| GenBank | AAG24921.1 | 2e-27 | 1 | 72 | 226 | 296 | AF311749_1 beta-1,3-glucanase [Hevea brasiliensis] |
| GenBank | ABR13272.1 | 6e-28 | 1 | 72 | 22 | 92 | putative beta-1,3-glucanase [Prunus dulcis] |
| EMBL | CAB38443.1 | 2e-27 | 1 | 72 | 262 | 332 | beta-1,3-glucanase [Hevea brasiliensis] |
| RefSeq | XP_002308921.1 | 6e-27 | 1 | 71 | 221 | 291 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3f55_D | 2e-28 | 1 | 72 | 226 | 296 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 3f55_C | 2e-28 | 1 | 72 | 226 | 296 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 3f55_B | 2e-28 | 1 | 72 | 226 | 296 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 3f55_A | 2e-28 | 1 | 72 | 226 | 296 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
| PDB | 3em5_D | 2e-28 | 1 | 72 | 226 | 296 | A Chain A, Crystal Structure Of A Native Endo Beta-1,3-Glucanase (Hev B 2), A Major Allergen From Hevea Brasiliensis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| JG067170 | 50 | 23 | 72 | 4e-26 |
| JG078852 | 50 | 23 | 72 | 5e-26 |
| JG069943 | 50 | 23 | 72 | 5e-26 |
| JG078331 | 50 | 23 | 72 | 4e-25 |
| JG009786 | 54 | 19 | 72 | 9e-19 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |