y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10038891
FamilyAA3
Protein PropertiesLength: 615 Molecular Weight: 67648.2 Isoelectric Point: 8.7927
ChromosomeChromosome/Scaffold: 34 Start: 708015 End: 711270
DescriptionGlucose-methanol-choline (GMC) oxidoreductase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA3675970
  APPVAFYDYIIIGGGTAGCPLAATLSRHAAVLVLERGGSPYNNSDITDVANFVSTIADTSPGSPSQTFVSEDGVYNTRARVLGGGSAIGAGFYSRAEANY
  VRRAGLDEELVRRSYEWVEWKIGFEPQVTKWQSTVREGMVETGVGPANGFTYAHDYGTKIGGTTFNTMGHRHSAADLLEYARPRNIKVYLHATVTKILFR
  RVRRWPRPIAYGVVYEDPMGIRKKAILKPHPHNEVILAAGAIGSPQLMMLSGIGPGLHLRSHGIQVVLDQPYVGQGMADNPMNLLYVPSPVPVETSLVQV
  VGIPYRQNSYIETASGLSFAYSWAQGFARDYVSFFNKTGKPSSLTAETIARAIETVHAYANTSQTTGGVILQKVKGPLSSGDLKLRSTSPNEDPSVSFNY
  YKSPRDLEGCVEGMRSIVRLINSPSFAKLRYPHLSVQALVDLILNLPVNLRPRHVSSSISLEQFCKDTVMTMWDYHGGCQVGKVVDPEYKVLGVDGLRVV
  DGSTLLRSPGTNPQATVMMLGRYTGRRILSE
Full Sequence
Protein Sequence     Length: 615     Download
MALHPSEIIL DSDGSIVFET DRMVLENTMH ENQSHLFTLL AVNFFLHCFC NSEKAPYFSF    60
VQEATTAPPV AFYDYIIIGG GTAGCPLAAT LSRHAAVLVL ERGGSPYNNS DITDVANFVS    120
TIADTSPGSP SQTFVSEDGV YNTRARVLGG GSAIGAGFYS RAEANYVRRA GLDEELVRRS    180
YEWVEWKIGF EPQVTKWQST VREGMVETGV GPANGFTYAH DYGTKIGGTT FNTMGHRHSA    240
ADLLEYARPR NIKVYLHATV TKILFRRVRR WPRPIAYGVV YEDPMGIRKK AILKPHPHNE    300
VILAAGAIGS PQLMMLSGIG PGLHLRSHGI QVVLDQPYVG QGMADNPMNL LYVPSPVPVE    360
TSLVQVVGIP YRQNSYIETA SGLSFAYSWA QGFARDYVSF FNKTGKPSSL TAETIARAIE    420
TVHAYANTSQ TTGGVILQKV KGPLSSGDLK LRSTSPNEDP SVSFNYYKSP RDLEGCVEGM    480
RSIVRLINSP SFAKLRYPHL SVQALVDLIL NLPVNLRPRH VSSSISLEQF CKDTVMTMWD    540
YHGGCQVGKV VDPEYKVLGV DGLRVVDGST LLRSPGTNPQ ATVMMLGRYT GRRILSERLP    600
LYLRRPPWHI PPRN*                                                     660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK02106PRK021061.0e-5443613178+
TIGR01810betA1.0e-2774598575+
PRK02106PRK021063.0e-3173345320+
COG2303BetA1.0e-3273600587+
PLN02785PLN02785044599588+
Gene Ontology
GO TermDescription
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI34759.104759921572unnamed protein product [Vitis vinifera]
RefSeqNP_200008.103959812576glucose-methanol-choline (GMC) oxidoreductase family protein [Arabidopsis thaliana]
RefSeqXP_002267807.103959813559PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002267848.103859812559PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002510860.103959912571glucose-methanol-choline (gmc) oxidoreductase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gdp_B05759811517A Chain A, Pectin Methylesterase From Carrot
PDB3gdp_A05759811517A Chain A, Pectin Methylesterase From Carrot
PDB3gdn_B05759811517A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB3gdn_A05759811517A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB1ju2_B05759811517A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO796743537745980
CO080148299493470
DT559636269533210
CK271873311733830
EE156290283513330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00460.1Aquca_013_00454.2Aquca_013_00454.1Aquca_013_00454.3Aquca_013_00454.5
Aquca_025_00060.1Aquca_013_00454.4Aquca_015_00360.2Aquca_015_00360.1Aquca_002_00625.1
Aquca_002_00624.1Aquca_013_00454.7Aquca_013_00454.6
Arabidopsis lyrata879508907040495263895153885302
476435918231334713920642
Arabidopsis thalianaAT1G12570.1AT3G56060.1AT1G72970.1AT5G51950.1AT5G51950.2
AT1G73050.1AT1G72970.2AT5G51930.1AT1G14190.1AT1G14185.1
Brachypodium distachyonBradi3g51670.1Bradi4g28870.1Bradi3g35310.2Bradi4g28870.2Bradi3g35310.1
Bradi3g31630.1Bradi5g18890.1Bradi1g77300.1Bradi1g31250.1
Brassica rapaBra016766Bra022571Bra008061Bra003862Bra029151
Bra028286Bra022570Bra016021Bra007212Bra007213
Bra029152Bra026850Bra008069
Carica papayaevm.model.supercontig_4.214evm.model.supercontig_131.52evm.model.supercontig_128.38evm.model.supercontig_128.39evm.model.supercontig_375.4
Capsella rubellaCarubv10008714mCarubv10019598mCarubv10028412mCarubv10016915mCarubv10020028m
Carubv10020023mCarubv10027769mCarubv10018458mCarubv10020012mCarubv10028260m
Carubv10008703m
Chlamydomonas reinhardtiiCre12.g514200.t1.2
Citrus clementinaCiclev10019611mCiclev10019456mCiclev10019427mCiclev10019445mCiclev10006541m
Ciclev10025184mCiclev10025302mCiclev10031199mCiclev10031316m
Citrus sinensisorange1.1g009272morange1.1g009241morange1.1g008331morange1.1g008675morange1.1g008281m
orange1.1g008163morange1.1g007210morange1.1g008715morange1.1g011442morange1.1g009873m
orange1.1g012707morange1.1g015588morange1.1g045695morange1.1g016822morange1.1g023276m
Cucumis sativusCucsa.341190.1Cucsa.360570.1Cucsa.359700.1Cucsa.089560.1Cucsa.089580.1
Cucsa.089600.1Cucsa.089550.1Cucsa.089500.1Cucsa.089610.1Cucsa.089510.1
Cucsa.302690.1Cucsa.089540.1Cucsa.089570.2Cucsa.068910.1Cucsa.089570.1
Cucsa.089590.1
Eucalyptus grandisEucgr.E00525.1Eucgr.A02842.1Eucgr.F03132.1Eucgr.J03148.1Eucgr.G02495.1
Fragaria vescamrna32372.1-v1.0-hybridmrna13343.1-v1.0-hybridmrna05701.1-v1.0-hybridmrna23054.1-v1.0-hybridmrna27390.1-v1.0-hybrid
Glycine maxGlyma17g14130.1Glyma05g03580.1Glyma20g29370.1Glyma07g01220.2Glyma08g20600.2
Glyma11g02930.1Glyma13g42630.1Glyma15g02790.1Glyma0615s00250.1Glyma07g00530.1
Glyma02g12060.2Glyma01g05890.2Glyma10g38480.2Glyma0615s00200.2
Gossypium raimondiiGorai.004G207200.2Gorai.004G207200.1Gorai.004G207200.4Gorai.004G207200.3Gorai.008G243300.1
Gorai.007G009900.1Gorai.009G142000.1Gorai.011G064300.1Gorai.011G199100.1Gorai.011G064300.2
Gorai.008G281500.1Gorai.009G117900.1Gorai.005G141700.1Gorai.009G142000.2Gorai.011G064300.3
Gorai.009G142000.3Gorai.009G142000.5Gorai.009G142000.4Gorai.004G207200.6Gorai.004G207200.5
Gorai.004G207200.7Gorai.004G207200.8Gorai.004G207200.10Gorai.011G064300.4
Linum usitatissimumLus10015623Lus10017827Lus10003176Lus10037640Lus10024487
Lus10002957Lus10027406Lus10031663Lus10015012Lus10030459
Lus10026607Lus10032641Lus10030457Lus10030456Lus10030461
Lus10033390Lus10030460Lus10012816Lus10034845Lus10026606
Lus10012817Lus10030462Lus10030458Lus10012818Lus10030463
Lus10003833Lus10024728Lus10032347
Malus domesticaMDP0000451172MDP0000185338MDP0000158474MDP0000425135MDP0000318256
MDP0000248951MDP0000903805MDP0000136847MDP0000137211MDP0000257243
MDP0000561228MDP0000130099MDP0000232295MDP0000177641MDP0000465595
MDP0000251783MDP0000288439.474.954MDP0000288439.474.954MDP0000184832MDP0000272655
MDP0000288439.45.461MDP0000288439.45.461MDP0000727481MDP0000748068MDP0000210966
MDP0000269370MDP0000151331MDP0000256300MDP0000192359MDP0000214280
MDP0000124051
Manihot esculentacassava4.1_004445mcassava4.1_004024mcassava4.1_029597mcassava4.1_003829mcassava4.1_031834m
cassava4.1_024092m
Medicago truncatulaMedtr5g011010.1Medtr5g011020.1Medtr2g100070.1Medtr1g101770.1Medtr4g005860.1
Medtr5g041340.1Medtr1g101760.1
Mimulus guttatusmgv1a003421mmgv1a003962mmgv1a025723mmgv1a003898mmgv1a025036m
mgv1a007376m
Oryza sativaLOC_Os02g45530.1LOC_Os09g19930.1LOC_Os04g48400.1LOC_Os08g31030.1LOC_Os10g38050.1
LOC_Os03g02700.1LOC_Os06g44540.1
Panicum virgatumPavirv00022245mPavirv00037597mPavirv00009521mPavirv00060828mPavirv00034775m
Pavirv00062067mPavirv00054028mPavirv00032583mPavirv00020766mPavirv00001081m
Pavirv00019408m
Physcomitrella patensPp1s3_628V6.1Pp1s78_69V6.1Pp1s78_68V6.1Pp1s472_10V6.1Pp1s85_157V6.1
Phaseolus vulgarisPhvul.003G213000.1Phvul.010G139000.1Phvul.005G159400.1Phvul.007G066200.1Phvul.010G162900.1
Phvul.002G084200.1
Picea abiesMA_159144g0050MA_46380g0010MA_115358g0010MA_41268g0010MA_10307468g0010
MA_10434495g0020MA_10432967g0010MA_3249g0010MA_15634g0010MA_68670g0010
MA_137064g0010MA_19258g0020MA_762g0010MA_10434427g0010MA_111884g0010
MA_577764g0010MA_11792g0020MA_10433135g0010MA_269764g0010MA_101730g0010
MA_159149g0270MA_159153g0080MA_159155g0150MA_147482g0030MA_159142g0110
Populus trichocarpaPotri.001G111500.8Potri.001G111500.1Potri.001G200800.1Potri.001G111500.7Potri.003G039000.1
Potri.003G039000.2Potri.008G009600.1Potri.012G135200.1Potri.008G087400.1Potri.010G168200.2
Potri.010G168200.1Potri.001G111500.4Potri.010G168100.2Potri.010G168100.1Potri.001G111500.6
Potri.001G111500.2Potri.001G111500.5Potri.001G111500.3Potri.010G249500.1
Prunus persicappa003422mppa016983mppa022070mppa015533mppa004308m
ppa003595mppa017360mppa022916mppa003414mppa020579m
Ricinus communis30147.m01432630190.m01111128694.m00067029813.m00150029748.m000381
Setaria italicaSi029318mSi013472mSi019398mSi011855mSi040002m
Si038995mSi008640m
Selaginella moellendorffii100345108291407760153538410833
9080911260380819132959410832
23255540476942952340596052668
81946235799427468413925402042
Sorghum bicolorSb04g031910.1Sb06g025960.1Sb07g019920.1Sb02g023010.1Sb01g031110.1
Sb01g049320.1Sb10g026110.1
Thellungiella halophilaThhalv10007216mThhalv10018308mThhalv10013065mThhalv10018360mThhalv10015625m
Thhalv10005870mThhalv10007408mThhalv10015735mThhalv10015262m
Vitis viniferaGSVIVT01010650001GSVIVT01019871001GSVIVT01016856001GSVIVT01010648001GSVIVT01013124001
Volvox carteriVocar20013934mVocar20013933m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)