Basic Information | |
---|---|
Species | Linum usitatissimum |
Cazyme ID | Lus10039150 |
Family | GH28 |
Protein Properties | Length: 125 Molecular Weight: 13324.5 Isoelectric Point: 8.5861 |
Chromosome | Chromosome/Scaffold: 34 Start: 1871216 End: 1871590 |
Description | Pectin lyase-like superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH28 | 2 | 107 | 2.1e-31 |
VKGIHFKNCTLTNTCNGVRIKSCPDLKAGSTTDISFEDIIMNNVSFPIVIDQVYCPWNTWKKTGVPSKVKISGVTYNNIRGTSATPQIVQMNCSSANPCE DIKLSA |
Full Sequence |
---|
Protein Sequence Length: 125 Download |
MVKGIHFKNC TLTNTCNGVR IKSCPDLKAG STTDISFEDI IMNNVSFPIV IDQVYCPWNT 60 WKKTGVPSKV KISGVTYNNI RGTSATPQIV QMNCSSANPC EDIKLSACAS VKPIVTGTIP 120 PGCV* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
PLN02218 | PLN02218 | 5.0e-16 | 2 | 123 | 131 | + polygalacturonase ADPG |
PLN02793 | PLN02793 | 4.0e-17 | 12 | 105 | 94 | + Probable polygalacturonase |
PLN02155 | PLN02155 | 3.0e-18 | 2 | 106 | 113 | + polygalacturonase |
pfam00295 | Glyco_hydro_28 | 1.0e-26 | 2 | 106 | 106 | + Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes is important in cell wall metabolism. |
PLN02188 | PLN02188 | 1.0e-26 | 2 | 123 | 141 | + polygalacturonase/glycoside hydrolase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004650 | polygalacturonase activity |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
DDBJ | BAA89476.1 | 8e-35 | 2 | 123 | 257 | 393 | polygalacturonase [Salix gilgiana] |
DDBJ | BAA89477.1 | 8e-35 | 2 | 123 | 257 | 393 | polygalacturonase [Salix gilgiana] |
DDBJ | BAA89478.1 | 3e-34 | 2 | 123 | 257 | 393 | polygalacturonase [Salix gilgiana] |
DDBJ | BAA89479.1 | 7e-35 | 2 | 123 | 257 | 393 | polygalacturonase [Salix gilgiana] |
RefSeq | XP_002329173.1 | 3e-34 | 2 | 119 | 17 | 148 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1ib4_B | 0.00003 | 2 | 102 | 217 | 313 | A Chain A, Ethylbenzene Dehydrogenase From Aromatoleum Aromaticum |
PDB | 1ib4_A | 0.00003 | 2 | 102 | 217 | 313 | A Chain A, Ethylbenzene Dehydrogenase From Aromatoleum Aromaticum |
PDB | 1ia5_A | 0.00003 | 2 | 102 | 217 | 313 | A Chain A, Polygalacturonase From Aspergillus Aculeatus |
PDB | 1bhe_A | 0.0004 | 2 | 101 | 262 | 353 | A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora |
PDB | 2iq7_G | 0.001 | 2 | 109 | 213 | 318 | A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
JG077668 | 137 | 2 | 125 | 0 |
JG075606 | 137 | 2 | 125 | 0 |
JG080773 | 131 | 2 | 119 | 0 |
GW616557 | 136 | 4 | 123 | 9e-33 |
GW615660 | 136 | 4 | 123 | 1e-32 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |