y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10042249
FamilyAA1
Protein PropertiesLength: 521 Molecular Weight: 57406 Isoelectric Point: 9.9091
ChromosomeChromosome/Scaffold: 123 Start: 1407167 End: 1409050
Descriptionlaccase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA12005030
  VVEADASYTKPFTTSVIMVGPAQTTNVLLKADQTPGRYYMAARAYQTAQNAAFDNTTTTAILEYKSTKGRASPVLPQLPAFNDTNTARAFTSQVRSLKSN
  VNVPKKIDKSLFFTVGLGLNNCTNPNSPRCQGPNGTRFTASINNVSFVFPRRNSLMQAYVQGQPGIFTTDFPSSPPVKFDYTGNVSRGLWQPSRGTKLVK
  LKYGDNVQIVLQDTSIVTTEDHPMHLHGYSFYVVGMGTGNFNAATDTANFNLVDPPHRNTIGTPPGGWVAIRFKADNPGIWLLHCHIDSHLGWGLATALL
  VENG
Full Sequence
Protein Sequence     Length: 521     Download
MISSHGVRQL RNPWADGPEY VTQCPIQPGR SYTYRFTIQN QEGTLWWHAH SKWLRATVHG    60
ALIIRPKKGS SYPFPTPKRE FPIILGEWWD RNPQDVLKLS QWTGAAANVS DAYTVNGQPG    120
DFYRCSNKGL PFPFFPSYHL LKTPVTNNST NFLIWSKCRN SEGPSGCRGN STPQNHKCCN    180
EPRTLLFGGK PQAHCRGSPV VEADASYTKP FTTSVIMVGP AQTTNVLLKA DQTPGRYYMA    240
ARAYQTAQNA AFDNTTTTAI LEYKSTKGRA SPVLPQLPAF NDTNTARAFT SQVRSLKSNV    300
NVPKKIDKSL FFTVGLGLNN CTNPNSPRCQ GPNGTRFTAS INNVSFVFPR RNSLMQAYVQ    360
GQPGIFTTDF PSSPPVKFDY TGNVSRGLWQ PSRGTKLVKL KYGDNVQIVL QDTSIVTTED    420
HPMHLHGYSF YVVGMGTGNF NAATDTANFN LVDPPHRNTI GTPPGGWVAI RFKADNPGIW    480
LLHCHIDSHL GWGLATALLV ENGVGKLQAV QAAPLDLPRC *                        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03388ascorbase2.0e-1629191+
TIGR03388ascorbase2.0e-40200507317+
PLN02191PLN021913.0e-461507532+
PLN02604PLN026041.0e-482507530+
TIGR03389laccase05520520+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_180580.10252082570LAC3 (laccase 3); laccase [Arabidopsis thaliana]
RefSeqNP_196330.30552081569LAC13 (laccase 13); laccase [Arabidopsis thaliana]
RefSeqXP_002319955.10552092576predicted protein [Populus trichocarpa]
RefSeqXP_002326089.10552092576predicted protein [Populus trichocarpa]
RefSeqXP_002516345.10552092577laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0151558536A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1asq_A0151558536A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1asp_B0151558536A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1asp_A0151558536A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB1aso_B0151558536A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79767552625210
DW2437222822074810
EX2740373122005020
DY2972482912004830
BQ9667472622344950
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00805.1
Brassica rapaBra005698.306.628Bra005698.306.628
Capsella rubellaCarubv10002796m
Citrus sinensisorange1.1g016876m
Eucalyptus grandisEucgr.B00926.1Eucgr.L00618.1Eucgr.C03119.1Eucgr.D00739.2Eucgr.D00739.1
Eucgr.C04047.1Eucgr.F02651.1Eucgr.E04215.1
Fragaria vescamrna17622.1-v1.0-hybridmrna20734.1-v1.0-hybrid.267.525mrna20734.1-v1.0-hybrid.267.525
Linum usitatissimumLus10026401Lus10006157.329.565Lus10006157.329.565
Malus domesticaMDP0000478260MDP0000126274.271.513MDP0000126274.271.513MDP0000192322.262.504MDP0000192322.262.504
MDP0000226556.262.504MDP0000226556.262.504MDP0000139079MDP0000258933.740.941MDP0000258933.740.941
Manihot esculentacassava4.1_011108mcassava4.1_012403m
Medicago truncatulaMedtr3g071890.2
Oryza sativaLOC_Os10g30140.1LOC_Os01g27700.1LOC_Os03g18640.1
Panicum virgatumPavirv00067346m.355.586Pavirv00011031mPavirv00044566mPavirv00002879mPavirv00051916m
Pavirv00063725mPavirv00032843mPavirv00067346m.355.586Pavirv00051097m
Picea abiesMA_97119g0020MA_63042g0010MA_10191230g0010MA_7035458g0010MA_812936g0010
MA_115131g0010MA_8558020g0010MA_73829g0020MA_945295g0010MA_775445g0010
MA_21316g0010.255.559MA_21316g0010.255.559MA_8210355g0010
Populus trichocarpaPotri.013G152700.3
Ricinus communis28644.m000936
Setaria italicaSi034761m.360.589Si034761m.360.589
Sorghum bicolorSb08g000720.1
Vitis viniferaGSVIVT01034822001.347.597GSVIVT01034822001.347.597GSVIVT01012745001GSVIVT01034820001GSVIVT01012746001
GSVIVT01034822001.12.242GSVIVT01034822001.12.242GSVIVT01034833001GSVIVT01013687001.88.319GSVIVT01013687001.88.319
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny