y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10043048
FamilyGH1
Protein PropertiesLength: 615 Molecular Weight: 69233.1 Isoelectric Point: 6.0251
ChromosomeChromosome/Scaffold: 25 Start: 878067 End: 881482
DescriptionGlycosyl hydrolase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11795140
  MGIDWTRIMPDEPVNGLKDAVNFAALERYKWIISRVHSYGMKVMLTLFHHSLPPWAGEYGGWKLEKTVDYFMDFTRLVVDAVSELVDYWITFNEPHIFCM
  LTYCAGAWPGGHPDMLEVATSALPTGVFNQSMNWIALAHSKAYAFIHENCINPVVGVAHHVSYMRPYGLFDVSAVQFANSLTIFPFIDSIAEKLDYIGIN
  YYGQEVVSGAGLKLVETDEYSESGRGVYPDGLFRVLLQFHERYKHLKVPFIITENGVADETDVIRMPYLLEHLLAVYAAMILGIPVLGYLFWTISDNWEW
  ADGYGPKFGLVAVDRNNNLARNPRPSYHLFSKVARS
Full Sequence
Protein Sequence     Length: 615     Download
MAFLTLVVSA TKVAGVLVSL TVASNAISFW RFQKKNLKSF EPGIDETSEV LAAFNVDGGE    60
SEFFFGLATA PAHVEDRLND AWLQFAEETP AGVSLPQGDL QPADAVLVSA GEEGGSQQAS    120
VSPKELAKVV KRKKSIKVSM EAMIRGFEKY TEEEEEEVPL PSEEFHHNVA AWHNVPHPMG    180
IDWTRIMPDE PVNGLKDAVN FAALERYKWI ISRVHSYGMK VMLTLFHHSL PPWAGEYGGW    240
KLEKTVDYFM DFTRLVVDAV SELVDYWITF NEPHIFCMLT YCAGAWPGGH PDMLEVATSA    300
LPTGVFNQSM NWIALAHSKA YAFIHENCIN PVVGVAHHVS YMRPYGLFDV SAVQFANSLT    360
IFPFIDSIAE KLDYIGINYY GQEVVSGAGL KLVETDEYSE SGRGVYPDGL FRVLLQFHER    420
YKHLKVPFII TENGVADETD VIRMPYLLEH LLAVYAAMIL GIPVLGYLFW TISDNWEWAD    480
GYGPKFGLVA VDRNNNLARN PRPSYHLFSK VARSGKITRE DRERAWGELQ SAAKEKKTRP    540
FYRAVNKYGL MYAGGLDEPI EREYIARDWR FGHYEMEGLQ DPLSRLSRCV VRPFIRKRKG    600
RRIAEPVVLQ PLAA*                                                     660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR01233lacG5.0e-20179492387+
PRK13511PRK135111.0e-27181517413+
TIGR03356BGL6.0e-52181508371+
pfam00232Glyco_hydro_12.0e-52181514390+
COG2723BglB2.0e-61179523401+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ87636.1016121635putative beta-glycosidase [Glycine max]
EMBLCAJ87637.1016141640putative beta-glycosidase [Solanum lycopersicum]
EMBLCBI22845.1016121615unnamed protein product [Vitis vinifera]
RefSeqXP_002280268.1016121644PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316058.1016111611predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ha4_A6e-3916352064471A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB4ha3_A6e-3916352064471A Chain A, Structure Of Beta-Glycosidase From Acidilobus Saccharovorans In Complex With Tris
PDB1vff_A3e-3617952469415A Chain A, Beta-Glycosidase From Pyrococcus Horikoshii
PDB3apg_D3e-35187520111460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
PDB3apg_C3e-35187520111460A Chain A, Crystal Structure Of Hyperthermophilic Beta-Glucosidase From Pyrococcus Furiosus
Transmembrane Domains
StartEnd
1330
451473
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8410083251795000
CX0459473042555560
GO8386793242806000
GO8544993301865120
GO8579233021954930
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_073_00022.2Aquca_073_00022.1Aquca_073_00022.3Aquca_073_00022.4
Arabidopsis lyrata477956
Arabidopsis thalianaAT3G06510.1AT3G06510.2
Brachypodium distachyonBradi4g09920.1
Brassica rapaBra040275Bra029584
Capsella rubellaCarubv10013225m
Citrus clementinaCiclev10004508mCiclev10004510mCiclev10004513mCiclev10004514mCiclev10004507m
Ciclev10004684m
Citrus sinensisorange1.1g008043m.64.291orange1.1g008043m.327.475orange1.1g008043m.327.475orange1.1g008043m.64.291orange1.1g008982m
orange1.1g006266morange1.1g006265morange1.1g006252morange1.1g006261morange1.1g011240m
orange1.1g008980m
Cucumis sativusCucsa.246950.2Cucsa.246950.1
Eucalyptus grandisEucgr.H04080.1Eucgr.H04080.2
Fragaria vescamrna05024.1-v1.0-hybrid
Glycine maxGlyma07g36470.2Glyma05g06465.1Glyma17g04130.1
Gossypium raimondiiGorai.006G080700.1Gorai.006G080700.2
Linum usitatissimumLus10011147
Malus domesticaMDP0000187687
Manihot esculentacassava4.1_003404m
Mimulus guttatusmgv1a023966m
Oryza sativaLOC_Os11g45710.1LOC_Os11g45710.2LOC_Os11g45710.3LOC_Os11g45710.4LOC_Os11g45710.5
LOC_Os11g45710.6LOC_Os11g45710.7
Panicum virgatumPavirv00063330mPavirv00063329mPavirv00005855m
Physcomitrella patensPp1s37_35V6.1Pp1s25_336V6.1
Phaseolus vulgarisPhvul.003G118100.1Phvul.003G118100.2
Picea abiesMA_36535g0010MA_10436797g0010MA_194231g0010MA_10111401g0010MA_7936147g0010
Populus trichocarpaPotri.010G149500.3Potri.010G149500.1Potri.010G149500.2
Prunus persicappa002585m
Ricinus communis29889.m003347.69.28529889.m003347.319.46729889.m003347.319.46729889.m003347.69.285
Setaria italicaSi026098mSi026096m
Selaginella moellendorffii110274935
Sorghum bicolorSb05g026810.3Sb05g026810.2Sb05g026810.1
Thellungiella halophilaThhalv10020302m
Vitis viniferaGSVIVT01034947001
Zea maysAC148152.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny