y PlantCAZyme

CAZyme Information

Basic Information
SpeciesLinum usitatissimum
Cazyme IDLus10043093
FamilyGH1
Protein PropertiesLength: 355 Molecular Weight: 39865.1 Isoelectric Point: 6.2209
ChromosomeChromosome/Scaffold: 25 Start: 1120986 End: 1124383
Descriptionbeta-glucosidase 47
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH11843453.4e-33
  GNSDLEPLIAVHNMILSHAKAVKIYRQEFQESKGGSIGIVLFAMWYQPLRENEVLDQQAVSRALAFGSPWLLDPLVYGDYPSEMRQYLGATLHSFTAEQM
  DYVKGSIDFIGLNHYSTLYAKDWLHSSCPPGGSDHAIRDFLSRSSAQSVGFSLVPGRLHETL
GH1341680
  RSHFPNGFLFGTATSAYQIEGAYLEDGKGLNNWDVVCHIPGNIKKNDNGDIADNHYHLFLEDIELMLALGVNSCRFSISWTRILHRGRFGEVNQMGIQFY
  RILDHLLLKGIEPFVTIHHHDIPQELEDKYGGWGS
Full Sequence
Protein Sequence     Length: 355     Download
MAQTRKRTVT RQLVLFLCFL STHCLEESDE EARRSHFPNG FLFGTATSAY QIEGAYLEDG    60
KGLNNWDVVC HIPGNIKKND NGDIADNHYH LFLEDIELML ALGVNSCRFS ISWTRILHRG    120
RFGEVNQMGI QFYRILDHLL LKGIEPFVTI HHHDIPQELE DKYGGWGSYP PSHCSPPFGN    180
CSAGNSDLEP LIAVHNMILS HAKAVKIYRQ EFQESKGGSI GIVLFAMWYQ PLRENEVLDQ    240
QAVSRALAFG SPWLLDPLVY GDYPSEMRQY LGATLHSFTA EQMDYVKGSI DFIGLNHYST    300
LYAKDWLHSS CPPGGSDHAI RDFLSRSSAQ SVGFSLVPGR LHETLINNGV VDTM*         360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029985.0e-7514305337+
PLN02814PLN028144.0e-8011302337+
TIGR03356BGL3.0e-8138313310+
PLN02849PLN028492.0e-8213300332+
pfam00232Glyco_hydro_11.0e-9237317316+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20347.101332418361unnamed protein product [Vitis vinifera]
Swiss-ProtQ7XSK003433329373BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor
RefSeqXP_002281986.103732436365PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329151.10343241333predicted protein [Populus trichocarpa]
RefSeqXP_002448179.1023334384hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A03430414327A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB3gnp_A03430414327A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB3gno_A03430414327A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3f5l_B03430417326A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB3f5l_A03430417326A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY291078277172490
GO840911313152820
DY965900306523130
GO873406319152870
DY291078472532990.0000003
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_054_00064.1.85.195Aquca_054_00064.1.85.195
Gossypium raimondiiGorai.013G167400.3.39.156Gorai.013G167400.3.39.156
Linum usitatissimumLus10043093.34.168Lus10043093.34.168
Panicum virgatumPavirv00045917mPavirv00016250m
Selaginella moellendorffii73365.31.20073365.31.200
Sorghum bicolorSb06g022480.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny