y
Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00016250m |
Family | GH1 |
Protein Properties | Length: 140 Molecular Weight: 15607.7 Isoelectric Point: 6.5156 |
Chromosome | Chromosome/Scaffold: 063159 Start: 3090 End: 4972 |
Description | beta-glucosidase 47 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH1 | 28 | 139 | 0 |
RSDFPAAFLFGTATSSYQIEGAYLEGNKSLSNWDVLTHLPGRVNDGSTGDIADDHYHRFEDDVELIHSLGTNAYRLSISWARILPRGRFGKVNPAGIEFY NKLIDALLLKGV |
Full Sequence |
---|
Protein Sequence Length: 140 Download |
MAGGEVWRPL LAGAWLLWLL PWASAVRRSD FPAAFLFGTA TSSYQIEGAY LEGNKSLSNW 60 DVLTHLPGRV NDGSTGDIAD DHYHRFEDDV ELIHSLGTNA YRLSISWARI LPRGRFGKVN 120 PAGIEFYNKL IDALLLKGVY 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02998 | PLN02998 | 2.0e-30 | 28 | 139 | 112 | + beta-glucosidase | ||
PLN02814 | PLN02814 | 7.0e-31 | 25 | 139 | 115 | + beta-glucosidase | ||
COG2723 | BglB | 2.0e-42 | 31 | 140 | 112 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
pfam00232 | Glyco_hydro_1 | 4.0e-48 | 31 | 139 | 109 | + Glycosyl hydrolase family 1. | ||
TIGR03356 | BGL | 4.0e-51 | 32 | 139 | 108 | + beta-galactosidase. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
GO:0005975 | carbohydrate metabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001140717.1 | 0 | 1 | 139 | 1 | 146 | hypothetical protein LOC100272792 [Zea mays] |
RefSeq | NP_001148165.1 | 0 | 8 | 139 | 9 | 145 | beta-glucosidase [Zea mays] |
Swiss-Prot | Q7XSK0 | 0 | 26 | 139 | 27 | 140 | BGL18_ORYSJ RecName: Full=Beta-glucosidase 18; Short=Os4bglu18; Flags: Precursor |
RefSeq | XP_002448178.1 | 0 | 20 | 139 | 25 | 145 | hypothetical protein SORBIDRAFT_06g022500 [Sorghum bicolor] |
RefSeq | XP_002448179.1 | 0 | 8 | 139 | 14 | 150 | hypothetical protein SORBIDRAFT_06g022510 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3ahx_D | 5e-35 | 31 | 139 | 6 | 113 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
PDB | 3ahx_C | 5e-35 | 31 | 139 | 6 | 113 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
PDB | 3ahx_B | 5e-35 | 31 | 139 | 6 | 113 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
PDB | 3ahx_A | 5e-35 | 31 | 139 | 6 | 113 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
PDB | 2wc4_D | 1e-34 | 23 | 139 | 22 | 135 | A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
Signal Peptide | ||||
---|---|---|---|---|
Cleavage Site | ||||
25 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE603029 | 139 | 1 | 139 | 0 |
FL805356 | 139 | 1 | 139 | 0 |
FL889291 | 112 | 28 | 139 | 0 |
FL872454 | 139 | 1 | 139 | 0 |
FL857933 | 116 | 24 | 139 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|