| Basic Information | |
|---|---|
| Species | Sorghum bicolor |
| Cazyme ID | Sb06g022480.1 |
| Family | GH1 |
| Protein Properties | Length: 152 Molecular Weight: 16820 Isoelectric Point: 4.4645 |
| Chromosome | Chromosome/Scaffold: 6 Start: 51707774 End: 51712662 |
| Description | beta glucosidase 46 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH1 | 30 | 145 | 9.6003e-42 |
| GQFPDSFLFGTSTSAYQIEGAYLEGNRGLSTWDVFSHKLGTIEDGSNGETTADHYHHYLEDIELMHSLGVNSYRFSIRGQEFYQLLLVAGGQFGHVNLDG IAFYNDLIDALLQKGI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 152 Download |
| MMAAEVVWLL LLLAHELLPC PCAASAVDRG QFPDSFLFGT STSAYQIEGA YLEGNRGLST 60 WDVFSHKLGT IEDGSNGETT ADHYHHYLED IELMHSLGVN SYRFSIRGQE FYQLLLVAGG 120 QFGHVNLDGI AFYNDLIDAL LQKGIPMEFM R* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02998 | PLN02998 | 2.0e-22 | 29 | 145 | 117 | + beta-glucosidase | ||
| PLN02814 | PLN02814 | 3.0e-25 | 26 | 145 | 120 | + beta-glucosidase | ||
| COG2723 | BglB | 7.0e-37 | 31 | 145 | 120 | + Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | ||
| TIGR03356 | BGL | 1.0e-40 | 33 | 145 | 116 | + beta-galactosidase. | ||
| pfam00232 | Glyco_hydro_1 | 1.0e-40 | 29 | 147 | 120 | + Glycosyl hydrolase family 1. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | NP_001053302.1 | 0 | 2 | 145 | 1 | 137 | Os04g0513100 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001140717.1 | 5.60519e-45 | 6 | 145 | 18 | 146 | hypothetical protein LOC100272792 [Zea mays] |
| RefSeq | XP_002448173.1 | 0 | 2 | 145 | 1 | 137 | hypothetical protein SORBIDRAFT_06g022450 [Sorghum bicolor] |
| RefSeq | XP_002448174.1 | 0 | 2 | 145 | 1 | 138 | hypothetical protein SORBIDRAFT_06g022460 [Sorghum bicolor] |
| RefSeq | XP_002448176.1 | 0 | 1 | 151 | 1 | 151 | hypothetical protein SORBIDRAFT_06g022480 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3scw_B | 3e-31 | 16 | 145 | 4 | 127 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scw_A | 3e-31 | 16 | 145 | 4 | 127 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scs_B | 4e-31 | 16 | 145 | 4 | 127 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scs_A | 4e-31 | 16 | 145 | 4 | 127 | A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose |
| PDB | 3scr_B | 4e-31 | 16 | 145 | 4 | 127 | A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| coumarin biosynthesis (via 2-coumarate) | RXN-8036 | EC-3.2.1.21 | β-glucosidase |
| linamarin degradation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-13602 | EC-3.2.1.21 | β-glucosidase |
| linustatin bioactivation | RXN-5341 | EC-3.2.1.21 | β-glucosidase |
| lotaustralin degradation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-13603 | EC-3.2.1.21 | β-glucosidase |
| neolinustatin bioactivation | RXN-9674 | EC-3.2.1.21 | β-glucosidase |
| taxiphyllin bioactivation | RXN-13600 | EC-3.2.1.21 | β-glucosidase |
| Signal Peptide | ||||
|---|---|---|---|---|
 | ||||
| Cleavage Site | ||||
| 24 | ||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| BE597018 | 121 | 25 | 145 | 0 |
| CA173257 | 121 | 25 | 145 | 0 |
| CN144920 | 121 | 25 | 145 | 0 |
| CD056472 | 123 | 25 | 145 | 0 |
| GH217203 | 123 | 25 | 145 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |