| Basic Information | |
|---|---|
| Species | Linum usitatissimum |
| Cazyme ID | Lus10043422 |
| Family | GH35 |
| Protein Properties | Length: 108 Molecular Weight: 11805.6 Isoelectric Point: 7.413 |
| Chromosome | Chromosome/Scaffold: 25 Start: 2783358 End: 2783758 |
| Description | beta-galactosidase 15 |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH35 | 42 | 105 | 9.1e-30 |
| TIDGKRRVLLSGSVHYPRSTPQMWPELISKAEEGGIDVIETYVFWNAHEPSRRQYDFSGNLDLI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 108 Download |
| MASTAAIALS QKLSLLFLLV LCASCVILSS ATTVSRDGRA ITIDGKRRVL LSGSVHYPRS 60 TPQMWPELIS KAEEGGIDVI ETYVFWNAHE PSRRQYDFSG NLDLISY* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG1874 | LacA | 8.0e-11 | 34 | 105 | 73 | + Beta-galactosidase [Carbohydrate transport and metabolism] | ||
| PLN03059 | PLN03059 | 1.0e-33 | 27 | 107 | 81 | + beta-galactosidase; Provisional | ||
| pfam01301 | Glyco_hydro_35 | 2.0e-34 | 40 | 104 | 65 | + Glycosyl hydrolases family 35. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CAJ09953.1 | 5e-40 | 16 | 107 | 7 | 98 | beta-galactosidase [Mangifera indica] |
| RefSeq | NP_683341.1 | 6e-40 | 13 | 107 | 27 | 118 | BGAL15 (beta-galactosidase 15); beta-galactosidase [Arabidopsis thaliana] |
| Swiss-Prot | Q9C6W4 | 6e-40 | 13 | 107 | 4 | 95 | BGL15_ARATH RecName: Full=Beta-galactosidase 15; Short=Lactase 15; Flags: Precursor |
| RefSeq | XP_002516237.1 | 5e-40 | 14 | 107 | 3 | 98 | beta-galactosidase, putative [Ricinus communis] |
| RefSeq | XP_002516256.1 | 3e-39 | 30 | 107 | 43 | 120 | beta-galactosidase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 4e8d_B | 0.00000000003 | 43 | 104 | 12 | 73 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 4e8d_A | 0.00000000003 | 43 | 104 | 12 | 73 | A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase |
| PDB | 4e8c_B | 0.00000000003 | 43 | 104 | 12 | 73 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 4e8c_A | 0.00000000003 | 43 | 104 | 12 | 73 | A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose |
| PDB | 3d3a_A | 0.0000000006 | 43 | 107 | 17 | 81 | A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron |
| Transmembrane Domains | |||||
|---|---|---|---|---|---|
 | |||||
| Start | End | ||||
| 13 | 35 | ||||
| Signal Peptide | |||||
|---|---|---|---|---|---|
 | |||||
| Cleavage Site | |||||
| 31 | |||||
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FR622350 | 81 | 27 | 107 | 3.00004e-41 |
| GR457807 | 86 | 25 | 107 | 8e-40 |
| EX045619 | 79 | 29 | 107 | 8e-39 |
| FD568609 | 80 | 28 | 107 | 2e-38 |
| DK510959 | 79 | 29 | 107 | 2e-38 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Eucalyptus grandis | Eucgr.A01556.1.37.100 | Eucgr.A01556.1.37.100 | |||
| Gossypium raimondii | Gorai.013G223000.1.33.116 | Gorai.013G223000.1.33.116 | |||
| Sequence Alignments |
|---|
 |
| Phylogeny |
|---|
 |