Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10060779g0010 |
Family | GH27 |
Protein Properties | Length: 96 Molecular Weight: 10564 Isoelectric Point: 4.3708 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH27 | 11 | 89 | 1.1e-29 |
FAQYTGPGGWKDPDMLEVGNGNMTPEEYGSHFNIWALMKAPLLIGCDVTSMDKKTYGILSNFEVIAVNQDPLGVQGKKV |
Full Sequence |
---|
Protein Sequence Length: 96 Download |
MISRADQNNE FAQYTGPGGW KDPDMLEVGN GNMTPEEYGS HFNIWALMKA PLLIGCDVTS 60 MDKKTYGILS NFEVIAVNQD PLGVQGKKVN KLGDLE |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03231 | PLN03231 | 3.0e-6 | 16 | 83 | 81 | + putative alpha-galactosidase; Provisional | ||
PLN02899 | PLN02899 | 3.0e-7 | 20 | 78 | 72 | + alpha-galactosidase | ||
PLN02692 | PLN02692 | 7.0e-42 | 1 | 96 | 96 | + alpha-galactosidase | ||
PLN02229 | PLN02229 | 3.0e-45 | 1 | 89 | 89 | + alpha-galactosidase | ||
PLN02808 | PLN02808 | 4.0e-52 | 1 | 96 | 96 | + alpha-galactosidase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK24922.1 | 9.00054e-42 | 1 | 96 | 223 | 318 | unknown [Picea sitchensis] |
GenBank | ABK25009.1 | 0 | 1 | 96 | 226 | 321 | unknown [Picea sitchensis] |
GenBank | ABR17777.1 | 0 | 1 | 79 | 48 | 126 | unknown [Picea sitchensis] |
DDBJ | BAC66445.1 | 1.99993e-41 | 1 | 96 | 258 | 353 | alpha-galactosidase [Helianthus annuus] |
RefSeq | XP_002314831.1 | 4.06377e-44 | 1 | 96 | 216 | 311 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1uas_A | 8.00001e-41 | 1 | 96 | 193 | 288 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
PDB | 3a5v_A | 2e-18 | 12 | 80 | 228 | 296 | A Chain A, Crystal Structure Of Alpha-Galactosidase I From Mortierella Vinacea |
PDB | 1ktc_A | 1e-17 | 14 | 93 | 226 | 305 | A Chain A, Crystal Structure Of Alpha-Galactosidase I From Mortierella Vinacea |
PDB | 1ktb_A | 1e-17 | 14 | 93 | 226 | 305 | A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase |
PDB | 3lrl_A | 2e-17 | 13 | 89 | 251 | 327 | A Chain A, The Structure Of Alpha-N-Acetylgalactosaminidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CK440299 | 96 | 1 | 96 | 0 |
DR499796 | 96 | 1 | 96 | 0 |
DR510788 | 96 | 1 | 96 | 0 |
DR509989 | 96 | 1 | 96 | 0 |
DV983592 | 96 | 1 | 96 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|