y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10149423g0010 |
Family | GH27 |
Protein Properties | Length: 115 Molecular Weight: 13096.2 Isoelectric Point: 5.1368 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH27 | 5 | 94 | 1.9e-25 |
ILSREDMNDRWAQCAGPGGWNDPDMLEVENGNLNREEYLLHFILWALMKAPLLIGCDMRNMSPGTVTILSNLEMIVVNQDPLGIQGKKVY |
Full Sequence |
---|
Protein Sequence Length: 115 Download |
MLCNILSRED MNDRWAQCAG PGGWNDPDML EVENGNLNRE EYLLHFILWA LMKAPLLIGC 60 DMRNMSPGTV TILSNLEMIV VNQDPLGIQG KKVYSKDSLE IHWEYKAKRS TAKTV 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN03231 | PLN03231 | 4.0e-5 | 20 | 87 | 81 | + putative alpha-galactosidase; Provisional | ||
PLN02899 | PLN02899 | 2.0e-5 | 24 | 113 | 103 | + alpha-galactosidase | ||
PLN02692 | PLN02692 | 5.0e-38 | 4 | 101 | 98 | + alpha-galactosidase | ||
PLN02229 | PLN02229 | 2.0e-40 | 10 | 93 | 84 | + alpha-galactosidase | ||
PLN02808 | PLN02808 | 1.0e-41 | 4 | 101 | 98 | + alpha-galactosidase |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1UAS | 4e-36 | 4 | 101 | 192 | 289 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
GenBank | ABK24922.1 | 4e-38 | 4 | 101 | 222 | 319 | unknown [Picea sitchensis] |
EMBL | CAA74160.1 | 1e-39 | 4 | 101 | 34 | 131 | alpha-galactosidase [Hordeum vulgare subsp. vulgare] |
RefSeq | XP_002325481.1 | 6e-37 | 4 | 95 | 206 | 297 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002467020.1 | 5e-37 | 4 | 101 | 256 | 353 | hypothetical protein SORBIDRAFT_01g018400 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1uas_A | 7e-38 | 4 | 101 | 192 | 289 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
PDB | 3s5z_B | 9e-20 | 12 | 104 | 219 | 310 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
PDB | 3s5z_A | 9e-20 | 12 | 104 | 219 | 310 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
PDB | 3s5y_B | 9e-20 | 12 | 104 | 219 | 310 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
PDB | 3s5y_A | 9e-20 | 12 | 104 | 219 | 310 | A Chain A, Crystal Structure Of Rice Alpha-Galactosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DR549393 | 97 | 4 | 100 | 0 |
CO234782 | 97 | 4 | 100 | 0 |
DR569269 | 101 | 1 | 101 | 0 |
EX352216 | 98 | 4 | 101 | 0 |
EX425533 | 99 | 3 | 101 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|