Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10149957g0010 |
Family | GT8 |
Protein Properties | Length: 236 Molecular Weight: 27319.7 Isoelectric Point: 6.6633 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT8 | 27 | 191 | 8e-24 |
YEFYVAIRVMLRSLIRLRVDADLVVIASKDVPPQWIRTLQADGVIVKPVDNMENPYKNQPGFNKLFTLMLNTLYAWTLVEYDRIVMLDADNLFLQNADEL FQCGQFCASFINLCIFHTRLFVLQPSVDVFHDMMHELKTLRRNRDGADQGFLVSYFNDLLDSLMF |
Full Sequence |
---|
Protein Sequence Length: 236 Download |
MEHWHLRSGA QKNVYATMMY MGTPRDYEFY VAIRVMLRSL IRLRVDADLV VIASKDVPPQ 60 WIRTLQADGV IVKPVDNMEN PYKNQPGFNK LFTLMLNTLY AWTLVEYDRI VMLDADNLFL 120 QNADELFQCG QFCASFINLC IFHTRLFVLQ PSVDVFHDMM HELKTLRRNR DGADQGFLVS 180 YFNDLLDSLM FYPPTNGSTS FNFFRRCDSQ SKPSAPIISV IMEKQKFGGG LECLLP 240 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00505 | Glyco_transf_8 | 4.0e-6 | 99 | 218 | 149 | + Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+. | ||
PLN00176 | PLN00176 | 2.0e-6 | 49 | 184 | 180 | + galactinol synthase | ||
pfam01501 | Glyco_transf_8 | 3.0e-10 | 26 | 184 | 196 | + Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase. | ||
cd06914 | GT8_GNT1 | 1.0e-10 | 30 | 186 | 169 | + GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases. | ||
cd02537 | GT8_Glycogenin | 3.0e-50 | 13 | 186 | 177 | + Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CAH67416.1 | 0 | 11 | 198 | 40 | 227 | OSIGBa0143N19.10 [Oryza sativa (indica cultivar-group)] |
GenBank | EEC77769.1 | 0 | 11 | 205 | 40 | 234 | hypothetical protein OsI_16920 [Oryza sativa Indica Group] |
RefSeq | NP_565817.2 | 0 | 7 | 199 | 57 | 250 | glycogenin glucosyltransferase (glycogenin)-related [Arabidopsis thaliana] |
RefSeq | XP_002269628.1 | 0 | 11 | 198 | 37 | 225 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002448294.1 | 0 | 11 | 198 | 41 | 228 | hypothetical protein SORBIDRAFT_06g024740 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3rmw_A | 0.00000000001 | 35 | 183 | 22 | 173 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1) T83m Mutant Complexed With Manganese And Udp-Glucose |
PDB | 3rmv_A | 0.00000000001 | 35 | 183 | 22 | 173 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1) T83m Mutant Complexed With Manganese And Udp-Glucose |
PDB | 3v91_A | 0.00000000002 | 94 | 183 | 102 | 192 | A Chain A, Crystal Structure Of Human Glycogenin-1 (Gyg1) T83m Mutant Complexed With Manganese And Udp-Glucose |
PDB | 3v90_A | 0.00000000002 | 94 | 183 | 102 | 192 | A Chain A, Structure Of T82m Glycogenin Mutant Truncated At Residue 270 |
PDB | 3u2x_B | 0.00000000006 | 35 | 183 | 22 | 173 | A Chain A, Structure Of T82m Glycogenin Mutant Truncated At Residue 270 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
GO366874 | 196 | 10 | 205 | 0 |
CT579318 | 177 | 29 | 205 | 0 |
DR688832 | 178 | 28 | 205 | 0 |
CT581076 | 169 | 37 | 205 | 0 |
DR693198 | 157 | 10 | 166 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|