Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10180832g0010 |
Family | GH47 |
Protein Properties | Length: 135 Molecular Weight: 15396.2 Isoelectric Point: 4.6892 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH47 | 53 | 135 | 1.1e-26 |
AWTCYNFYRSTPTKLAGENYHFREGQDMMVGTSWNIQRPETVESLMYLWRTTGNRTYREWGWEIFKSFEAQCRIDSGYVGLKD |
Full Sequence |
---|
Protein Sequence Length: 135 Download |
MTRPDPFPGD GCDPPDLIGS LPLPVSGVVD DSDTPPVPRH STILGFLHST LDAWTCYNFY 60 RSTPTKLAGE NYHFREGQDM MVGTSWNIQR PETVESLMYL WRTTGNRTYR EWGWEIFKSF 120 EAQCRIDSGY VGLKD |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PTZ00470 | PTZ00470 | 1.0e-27 | 55 | 135 | 84 | + glycoside hydrolase family 47 protein; Provisional | ||
pfam01532 | Glyco_hydro_47 | 4.0e-30 | 53 | 135 | 92 | + Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2). |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAK92711.1 | 7.00005e-41 | 53 | 135 | 407 | 489 | putative mannosidase [Arabidopsis thaliana] |
DDBJ | BAB01459.1 | 8.99998e-41 | 53 | 135 | 416 | 498 | alpha 1,2-mannosidase-like protein [Arabidopsis thaliana] |
RefSeq | NP_001031171.1 | 9.99995e-41 | 53 | 135 | 302 | 384 | mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Arabidopsis thaliana] |
RefSeq | NP_566675.1 | 8.00001e-41 | 53 | 135 | 407 | 489 | mannosyl-oligosaccharide 1,2-alpha-mannosidase, putative [Arabidopsis thaliana] |
RefSeq | XP_002325257.1 | 7.00005e-41 | 53 | 135 | 408 | 490 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1nxc_A | 0.000000000000002 | 53 | 135 | 330 | 415 | A Chain A, Structure Of Mouse Golgi Alpha-1,2-Mannosidase Ia Reveals The Molecular Basis For Substrate Specificity Among Class I Enzymes (Family 47 Glycosidases) |
PDB | 1x9d_A | 0.00000000000008 | 55 | 129 | 394 | 475 | A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue |
PDB | 1fo3_A | 0.0000000000001 | 55 | 129 | 316 | 397 | A Chain A, Crystal Structure Of Human Class I Alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue |
PDB | 1fo2_A | 0.0000000000001 | 55 | 129 | 316 | 397 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin |
PDB | 1fmi_A | 0.0000000000001 | 55 | 129 | 316 | 397 | A Chain A, Crystal Structure Of Human Class I Alpha1,2-Mannosidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BW989099 | 117 | 19 | 135 | 0 |
EX934395 | 117 | 19 | 135 | 1.96182e-44 |
CX286936 | 83 | 53 | 135 | 2.00386e-43 |
HS055072 | 83 | 53 | 135 | 2.99878e-43 |
GE648852 | 81 | 55 | 135 | 2.99878e-43 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|