Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10189777g0010 |
Family | CE10 |
Protein Properties | Length: 141 Molecular Weight: 15822.3 Isoelectric Point: 6.6588 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CE10 | 62 | 141 | 5.5e-25 |
DLEINPHTGIWARIYLPETLPDMNRVEKYPIVVHFHGGGFCIGSADWRCLNLFLSRLVKQCRVMCVSVDYRLAPEHRLPA |
Full Sequence |
---|
Protein Sequence Length: 141 Download |
MRLDHSMGKQ IIDEISGLLL IYSDGSIERP RSCKVDAADQ VNDLIAPVSA SQSFIDGVAT 60 RDLEINPHTG IWARIYLPET LPDMNRVEKY PIVVHFHGGG FCIGSADWRC LNLFLSRLVK 120 QCRVMCVSVD YRLAPEHRLP A |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00135 | COesterase | 2.0e-5 | 75 | 135 | 61 | + Carboxylesterase family. | ||
COG2272 | PnbA | 1.0e-5 | 75 | 136 | 62 | + Carboxylesterase type B [Lipid metabolism] | ||
PRK10162 | PRK10162 | 3.0e-7 | 58 | 140 | 86 | + acetyl esterase; Provisional | ||
COG0657 | Aes | 5.0e-15 | 35 | 141 | 108 | + Esterase/lipase [Lipid metabolism] | ||
pfam07859 | Abhydrolase_3 | 2.0e-19 | 93 | 141 | 49 | + alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK22368.1 | 4.00001e-40 | 7 | 141 | 1 | 133 | unknown [Picea sitchensis] |
GenBank | ABK24130.1 | 1e-39 | 7 | 141 | 1 | 133 | unknown [Picea sitchensis] |
GenBank | ABK24842.1 | 7e-39 | 7 | 141 | 1 | 133 | unknown [Picea sitchensis] |
RefSeq | XP_002278031.1 | 4e-33 | 9 | 141 | 5 | 133 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002525545.1 | 3e-33 | 9 | 141 | 5 | 133 | catalytic, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2o7v_A | 0.000000000000007 | 19 | 141 | 24 | 134 | A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima |
PDB | 2o7r_A | 0.000000000000007 | 19 | 141 | 24 | 134 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_F | 0.0000000008 | 14 | 140 | 27 | 162 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_E | 0.0000000008 | 14 | 140 | 27 | 162 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
PDB | 3ed1_D | 0.0000000008 | 14 | 140 | 27 | 162 | A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DV996284 | 135 | 7 | 141 | 0 |
GE480458 | 136 | 6 | 141 | 0 |
GH282071 | 135 | 7 | 141 | 0 |
DR692788 | 137 | 5 | 141 | 0 |
AM170816 | 135 | 7 | 141 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|