| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10305466g0010 |
| Family | GH17 |
| Protein Properties | Length: 101 Molecular Weight: 10975.1 Isoelectric Point: 4.2104 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 1 | 99 | 3.20001e-40 |
| DTLLSAMEALGYPNVPIVITESGWPSAGADVATVENAQAYNNNLIQHVLSNAGTPKRPGTSIETYIFALFNENKKEDPETERNFGIFNPDKSPAYSVNF | |||
| Full Sequence |
|---|
| Protein Sequence Length: 101 Download |
| DTLLSAMEAL GYPNVPIVIT ESGWPSAGAD VATVENAQAY NNNLIQHVLS NAGTPKRPGT 60 SIETYIFALF NENKKEDPET ERNFGIFNPD KSPAYSVNFS P |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG5309 | COG5309 | 6.0e-5 | 14 | 91 | 84 | + Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] | ||
| pfam00332 | Glyco_hydro_17 | 3.0e-42 | 1 | 99 | 99 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAV66572.1 | 9.94922e-44 | 1 | 101 | 243 | 343 | glucanase-like protein [Thuja occidentalis] |
| GenBank | ABK23947.1 | 0 | 1 | 101 | 244 | 344 | unknown [Picea sitchensis] |
| GenBank | ABK25991.1 | 1.4013e-45 | 1 | 101 | 241 | 342 | unknown [Picea sitchensis] |
| DDBJ | BAD93486.1 | 0 | 1 | 100 | 247 | 346 | pollen allergen CJP38 [Cryptomeria japonica] |
| RefSeq | XP_002459074.1 | 1e-37 | 1 | 100 | 236 | 332 | hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3ur8_B | 1e-32 | 1 | 100 | 216 | 315 | A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp |
| PDB | 3ur8_A | 1e-32 | 1 | 100 | 216 | 315 | A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp |
| PDB | 3ur7_B | 1e-32 | 1 | 100 | 216 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 3ur7_A | 1e-32 | 1 | 100 | 216 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| PDB | 4gzj_A | 9e-32 | 1 | 100 | 216 | 315 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR551649 | 101 | 1 | 101 | 0 |
| DR023891 | 101 | 1 | 101 | 0 |
| DR098857 | 101 | 1 | 101 | 0 |
| CO484154 | 101 | 1 | 101 | 0 |
| CO242059 | 101 | 1 | 101 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |