| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10334081g0010 |
| Family | PL1 |
| Protein Properties | Length: 84 Molecular Weight: 9411.45 Isoelectric Point: 6.1195 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| PL1 | 2 | 84 | 6e-34 |
| DGDGISIFTGRHIWVDHCSMSNCEDGLIDAVKSSTHITISNNYFTHHDKVMLLGHSDSYSEDRIMQVTVAFNHFGQGLTQRMP | |||
| Full Sequence |
|---|
| Protein Sequence Length: 84 Download |
| SDGDGISIFT GRHIWVDHCS MSNCEDGLID AVKSSTHITI SNNYFTHHDK VMLLGHSDSY 60 SEDRIMQVTV AFNHFGQGLT QRMP |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| COG3866 | PelB | 3.0e-19 | 4 | 84 | 91 | + Pectate lyase [Carbohydrate transport and metabolism] | ||
| pfam00544 | Pec_lyase_C | 1.0e-32 | 1 | 84 | 92 | + Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue. | ||
| smart00656 | Amb_all | 6.0e-35 | 1 | 84 | 93 | + Amb_all domain. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF63756.1 | 8.00001e-42 | 1 | 84 | 195 | 278 | AF243475_1 pectate lyase [Vitis vinifera] |
| GenBank | ABO28478.1 | 1.99965e-42 | 1 | 84 | 22 | 105 | pectate lyase precursor [Glycine max] |
| EMBL | CBI17713.1 | 3.99931e-42 | 1 | 84 | 200 | 283 | unnamed protein product [Vitis vinifera] |
| Swiss-Prot | P24396 | 9.99967e-42 | 1 | 84 | 199 | 282 | PEL18_SOLLC RecName: Full=Probable pectate lyase P18; AltName: Full=Style development-specific protein 9612; Flags: Precursor |
| RefSeq | XP_002268976.1 | 9.00054e-42 | 1 | 84 | 200 | 283 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 1pxz_B | 2e-26 | 2 | 84 | 149 | 231 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 1pxz_A | 2e-26 | 2 | 84 | 149 | 231 | A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen |
| PDB | 3zsc_A | 0.00000000000008 | 2 | 84 | 115 | 199 | A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima |
| PDB | 1vbl_A | 0.00000000007 | 1 | 84 | 187 | 287 | A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47 |
| PDB | 1bn8_A | 0.000000002 | 4 | 84 | 205 | 302 | A Chain A, Bacillus Subtilis Pectate Lyase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| FD730583 | 75 | 10 | 84 | 0 |
| GR004229 | 84 | 1 | 84 | 5.04467e-44 |
| CV052216 | 84 | 1 | 84 | 7.9874e-44 |
| EE488502 | 84 | 1 | 84 | 7.9874e-44 |
| CV052545 | 84 | 1 | 84 | 9.94922e-44 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |