| Basic Information | |
|---|---|
| Species | Picea abies |
| Cazyme ID | MA_10383303g0010 |
| Family | GH17 |
| Protein Properties | Length: 119 Molecular Weight: 12666.5 Isoelectric Point: 4.9679 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GH17 | 47 | 119 | 3e-24 |
| IGVNYGMLGDNLPPADQVVTLITNNNIGKTRIFAANRDALKAFANSGIDVIVGVGNDELEAISSSQDSANGWV | |||
| Full Sequence |
|---|
| Protein Sequence Length: 119 Download |
| MSVLAKHFSS LSFPLRNMAA SKEQTKIILI GFIAIFCCSI FTDGDKIGVN YGMLGDNLPP 60 ADQVVTLITN NNIGKTRIFA ANRDALKAFA NSGIDVIVGV GNDELEAISS SQDSANGWV 120 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 2.0e-23 | 47 | 119 | 73 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAL30426.1 | 1e-18 | 17 | 119 | 5 | 107 | AF435089_1 beta-1,3-glucanase [Prunus persica] |
| GenBank | AAV66572.1 | 9e-23 | 18 | 119 | 1 | 103 | glucanase-like protein [Thuja occidentalis] |
| GenBank | ABK23947.1 | 0 | 18 | 119 | 1 | 102 | unknown [Picea sitchensis] |
| GenBank | ABK25991.1 | 3e-31 | 26 | 119 | 5 | 98 | unknown [Picea sitchensis] |
| DDBJ | BAD93486.1 | 8e-28 | 22 | 119 | 6 | 103 | pollen allergen CJP38 [Cryptomeria japonica] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 0.000000000000009 | 47 | 119 | 1 | 73 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 0.000000000003 | 46 | 119 | 1 | 73 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 0.000000000003 | 46 | 119 | 1 | 73 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 0.000000000003 | 46 | 119 | 1 | 73 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 0.000000000003 | 46 | 119 | 1 | 73 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DR525153 | 110 | 10 | 119 | 0 |
| EX400101 | 109 | 11 | 119 | 0 |
| CO485400 | 103 | 17 | 119 | 0 |
| ES251244 | 99 | 21 | 119 | 0 |
| FY843456 | 110 | 10 | 119 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |